KEGG   Bos mutus (wild yak): 102286137
Entry
102286137         CDS       T02919                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05140  Leishmaniasis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286137 (JAK1)
   04151 PI3K-Akt signaling pathway
    102286137 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102286137 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102286137 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102286137 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102286137 (JAK1)
   04659 Th17 cell differentiation
    102286137 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102286137 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286137 (JAK1)
   05203 Viral carcinogenesis
    102286137 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102286137 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102286137 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102286137 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286137 (JAK1)
   05161 Hepatitis B
    102286137 (JAK1)
   05160 Hepatitis C
    102286137 (JAK1)
   05171 Coronavirus disease - COVID-19
    102286137 (JAK1)
   05164 Influenza A
    102286137 (JAK1)
   05162 Measles
    102286137 (JAK1)
   05168 Herpes simplex virus 1 infection
    102286137 (JAK1)
   05163 Human cytomegalovirus infection
    102286137 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286137 (JAK1)
   05169 Epstein-Barr virus infection
    102286137 (JAK1)
   05165 Human papillomavirus infection
    102286137 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102286137 (JAK1)
   05140 Leishmaniasis
    102286137 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102286137 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102286137 (JAK1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102286137 (JAK1)
Protein kinases [BR:bom01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102286137 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 102286137
NCBI-ProteinID: XP_005886754
LinkDB
Position
Un
AA seq 1158 aa
MQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTVTVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGNVLCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNI
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcagtgccatggctttctgtgctaaaatgagg
agctccaagaaggcagagatgaatctggaggcccctgagccgggggtggaggtgctcttc
tacctgtcggatagggagcctctccggctgggcggtggagagtacacggcggaggagctg
tgcattcgggcggcgcaggagtgctgtatctctcctctgtgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccgaatcgcaccgtcaccgtcgacgacaaa
acgtcactccggcttcactaccggatgaggttctatttcaccaactggcatgggaccaac
gacaatgaacaatcagtatggcgacattctccaaagaagcagaaaaacggctacgagaaa
aaaaaagttccagatgcaacacctctccttgacgccagctcgctggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcacgacattgagaacgagtgtcttgggatggccgtgctggccatctcccactac
gccatgatgaagaagatgcaattgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggattttctaaaggagtttaacaacaagaccatttgtgacagcagc
gtgtccacgcacgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatccaaatgatagtggaaatgttctctgctatgaagtgatggtgactggaaat
cttggaatccagtggagacagaaaccacatattgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggaaaaaaacaaaatccga
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtccttcgtgtccctggtcgatggctacttccggctcacggcagacgcccat
cactacctctgcactgacgtggctcccccattgatcgtccacaacatacagaatggctgt
catggtccaatctgcacggagtatgccatcaataagctgcggcaggaggggagcgaggag
gggatgtacgtgctgcggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgcttcgaaaagtctgaggtgctgggtatccagaaacagttcaagaactttcagatcgag
gtgcagaagggccgctacagcctgcatggctcggaccgcagcttcccgagccttggggac
ctcatgagccacctaaagaagcagatcctgcgcacggacaacatcagcttcgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctacaccatgagccagctgagtttcgatcgaatcctcaagaaa
gatattacgcaaggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaagggacttctgaagagaagagaataaaagtcatcctg
aaggtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggggtttgcgtccgagatgtg
gagaatatcatggtggaagagtttgtggaggggggacccctggacctcttcatgcaccgg
aaaagtgacgtcctcaccacaccctggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccacggaaatgtgtgcactaaaaacctcctt
ctggcccgcgagggcatcgacagtgagtgcggccccttcatcaagctcagtgaccctggc
atccccatcactgtgctctccaggcaagagtgcatagaacgaatcccctggattgctccc
gagtgtgttgaagactccaagaatctgagtgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgattgag
aaagagagattctatgaaagccggtgcaggccagtgaccccatcttgtaaggagctagct
gacttgatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacattgtatcagaaaaaaagcca
acaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaagtggctgtcaaatccctgaagcccgagagtggagggaaccacatcgctgat
ctgaagaaggagattgaaatcttaagaaatctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagatggtggaaatggtattaagctcatcatggagtttctgccttca
gggagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatatgccgttcagatttgtaaggggatggactatctgggttctcggcagtacgttcac
cgggacttagcagcaagaaacgtcctcgtggagagtgagcaccaggtgaaaatcggggac
ttcggtctcaccaaagccatcgaaactgataaggagtactacacagtcaaggacgaccgc
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttctatatcgcc
tctgatgtctggtctttcggagtgactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggccttgttcctgaaaatgataggcccaactcatggtcagatgacggta
acaagactcgtgaatacattaaaagaaggaaaacgcttgccatgtccaccgaactgtcca
gatgaggtttatcaacatatgcgaaagtgttgggaatttcaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttctaagaagcatgagtaacatttaa

DBGET integrated database retrieval system