KEGG   Bos mutus (wild yak): 102286213Help
Entry
102286213         CDS       T02919                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00430  Taurine and hypotaurine metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102286213 (CSAD)
Enzymes [BR:bom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     102286213 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF4910 SepSecS DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102286213
NCBI-ProteinID: XP_005902208
LinkDB All DBs
Position
Un
AA seq 494 aa AA seqDB search
MADSQPLLSLDGDPVAAEALLQDVFGIVVDEVIRKGTSASEKVCEWKEPEELKQLLDLEL
RHEGESQEQILEHCRAVIRYSVKTCHPRFFNQLFSGLDPHALAGRIVTESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARYQRYPDCKQRGLRALP
PLALFTSKECHYSIKKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAKAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQHHGLWLHVDAAWGGSVLLSQTHRHLLAGIQRADSVA
WNPHKLLSTGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGEQGLQRRVDQAFALARYLVEELKKREGFELVMEPEFVNVCFWFVPPS
LRGKKGSPDYSERLSKVAPILKERMVRKGSMMIGYQPHGTRSNFFRMVVANPALTRADVD
FLLKNELERLGQDL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgactctcagcctctcctctcccttgatggggaccctgtggctgcagaagccttg
ctccaggacgtgtttgggattgtggtggatgaggtcattcgaaaagggaccagtgcctcc
gagaaggtctgtgagtggaaggagcccgaggagctgaagcaactgctggacttggagctg
cggcacgagggcgagtcacaggagcagatcctggagcactgccgggctgtgatccgctac
agcgtgaagacctgtcaccctcgtttcttcaaccagctcttctcagggttggatccccat
gccctggccgggcgcattgtgacagagagcctcaacaccagccagtacacgtacgaaatc
gcccctgtgtttgtcctcatggaggaggaggtgctgaagaaactccgggccctggtgggc
tggagctctggggatggggtcttctgccctggtggctccatctccaacatgtatgcagtg
aacctggcccgctatcagcgatacccagactgcaaacagaggggcctccgggcactgccg
cccctggccctcttcacatcgaaagagtgtcattactccatcaagaaaggagccgctttt
ctgggacttggcaccgacagtgtccgagtggtcaaggcagatgagagagggaaaatgatc
cctgaggatctggagaggcagatcagcttggctaaggccgagggtgccgtgccattcctg
gtcagtgccacctctggtactacagtgctgggggcctttgaccccctggaggcaatcgca
gacgtgtgccagcatcacgggctgtggctgcatgtggacgctgcctggggtggaagcgtc
ctgctgtcacagacacatagacatctcctggctgggatccagagggctgactccgtggcc
tggaatccccacaagctcctctccacaggcctgcagtgctcagctcttcttctccgggac
acctcgaacctgctcaagcgctgtcacgggtcccaggccagctacctcttccagcaggac
aagttctacgatgtggctctggacacgggagacaaggtggtgcagtgtggccggcgtgtg
gactgtctgaagctgtggctcatgtggaaggcacagggcgagcaggggctgcagcgccgt
gtggaccaggcctttgcccttgcccggtacctggtggaggagctgaagaagcgggaggga
tttgagttggtcatggagcctgaatttgtcaatgtgtgtttctggttcgtgcccccgagt
ctgcgcgggaagaaggggagtccagattacagtgaaaggctgtctaaggtagccccaatc
ctcaaggagcgcatggtgaggaagggttccatgatgattggctaccagccccatggtacc
cggagcaacttctttcgcatggttgtggccaaccctgcactgacacgggctgatgtggac
ttcctgctaaaaaacgagctggaacggctgggccaggatctctga

DBGET integrated database retrieval system