KEGG   Bos mutus (wild yak): 102286413
Entry
102286413         CDS       T02919                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102286413 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102286413 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bom03310]
    102286413 (NR3C1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102286413 (NR3C1)
Nuclear receptors [BR:bom03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102286413 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102286413
NCBI-ProteinID: XP_005904354
LinkDB
Position
Un
AA seq 781 aa
MDPKESLSTPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKNSASTAVSAAPTEKEFPKTHSDVSSEQQNLKGQKGSNGG
NMKLYTTDQSTFDIWRKKLQDLEFSSGSPSKETSESPWSSDLLIDENCLLSPLAGEDDPF
LLEGSSNEDCKPLVLPDTKPKIKDNGDLILPSPSSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLL
EVIEPEVLYAGYDSSIPDSTWRIMTALNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLL
QYSWMFLMAFALGWRSYRQSCANMLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRL
QVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFY
QLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaccccaaggagtcattaagcacccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttccccctcactggctgctgcttctcagtcagactccaagcagcaa
agacttctggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactgtccatgggactgtacatgggagagacagagacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cgtcttctggaagaaagcatcgcaaacctcaataggtcaaccagtgttccagagaacccc
aagaattcggcatccactgctgtttctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtgtcttcagaacagcagaatttgaaaggccagaagggcagtaacgggggt
aatatgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaagctccag
gatttggagttttcttctgggtccccaagtaaagagacaagtgagagtccttggagctca
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattc
cttctggaaggaagctcgaatgaggactgtaagcctcttgttttaccggacactaagcct
aaaattaaagataatggagatttgatcttaccaagtcctagcagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttatcgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttattgtcaggccagcttttctggggccaatataattggtaataaa
atgtctgccatttctgttcacggtgtgagtacctctgggggccagatgtaccactacgac
atgaatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccaagggtctggagatgataacttg
acttccttggggactttgaacttctctggtcgatctgttttttctaacggctattcaagc
cctggaatgagaccagacgtaagttctcctccatccagttcctcagcagctacgggacca
cctcccaaactctgcctagtctgctctgatgaagcttcaggatgtcattatggggtcttg
acttgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctt
tgtgctggaagaaatgattgtatcattgataaaattcgaagaaaaaactgcccagcatgc
cgctatagaaaatgccttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaag
ataaaaggaattcagcaggccactacaggagtctcgcaagaaacttctgaaaatcctgct
aacaaaacaatagttcctgcaacattaccacaactcacacctacgctggtgtcactgctg
gaagtcattgaacccgaggtgttatatgcaggatatgacagctctattccagattcaact
tggcggatcatgaccgcactcaacatgttaggtgggcggcaggtgattgcagccgtgaaa
tgggcaaaggcaataccaggattcaggaacttacatctggatgaccaaatgactctactg
caatattcatggatgttcctcatggcatttgccttggggtggagatcatacagacaatca
tgtgcaaatatgctgtgttttgctcctgatctgattattaatgagcagagaatggcttta
ccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaaacaggctt
caggtatcttacgaagagtatctctgtatgaaaaccttactgctcctctcttcagttccc
aaggaaggcttgaagagtcaagaactatttgatgaaattagaatgacctatatcaaagag
ctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttat
caactgacaaaactcttggactccatgcatgatgtggttgaaaatcttcttaactattgc
ttccaaacatttttggataagactatgagtattgaattcccagagatgttagctgaaatc
atcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaa
aagtga

DBGET integrated database retrieval system