KEGG   Bos mutus (wild yak): 102286430
Entry
102286430         CDS       T02919                                 

Gene name
LTBR
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04064  NF-kappa B signaling pathway
bom04066  HIF-1 signaling pathway
bom04672  Intestinal immune network for IgA production
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102286430 (LTBR)
   04066 HIF-1 signaling pathway
    102286430 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286430 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102286430 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102286430 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102286430 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286430 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102286430 (LTBR)
Cytokine receptors [BR:bom04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102286430 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 102286430
NCBI-ProteinID: XP_014337550
LinkDB
Position
Un
AA seq 394 aa
MRLLWATSHRGLAWGLLILGVWGLLAASQPQLEREEPMQGLPYHTENQSCGDQEKEYYES
KLRLCCSRCPPGTHISTKCSRRQNTVCATCPEKSYNEHWNHLSFCQLCRPCDKMLGFVEL
TPCTSNRKAQCHCQPGMYCVFWNSECEHCEPLSDCPPGTEAELKDEVIEANSNCVPCKAG
HFQNTSSPTARCRPHTRCEDQGLVEEAPGTPQSDTSCRNPQEPPDMPGTMLVLAILLPLV
SFLLLTTVFVYTWKSHPSLCRKLGSLLKRHPEGEESNPADGNWEPPRFNTHVPDLVKPLL
PAPGDLALASGGVPANPGLEEEVLQQQSPLSQARDLDAEPPEQGQVAPGTNGIHVTGGSV
TVTAPRPPGLSMPYQEDGKAWHLAETETLGCYAL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcgcctgctatgggccacctcccaccgcggcctggcctgggggctactcatcctgggc
gtctggggtctcctggccgcatcccaaccccagctggagagggaggagcctatgcagggg
ctcccataccacacagagaaccaaagctgcggagaccaggaaaaggagtactatgagtcc
aagcttcgcctctgctgctcccgctgccccccaggcacgcacatctccaccaaatgtagc
cgccgccagaacaccgtctgtgccacatgccccgagaagtcgtacaacgagcactggaac
catctctccttctgccagctgtgccgcccctgtgacaagatgctgggcttcgtggagctc
acgccttgcactagcaaccgcaaggcccagtgccactgccagccggggatgtactgcgtc
ttttggaactccgagtgtgagcactgcgagccactctccgactgcccgcctggcaccgag
gccgagctcaaagatgaagtcatagaggctaacagcaactgtgtcccctgtaaagctgga
cacttccagaacacctcctctcccaccgcccgctgccggccccataccaggtgtgaggac
cagggccttgtggaggaagctccgggcaccccccagtctgacaccagctgcagaaatcca
caagagccccctgacatgccaggaacgatgctagttctggccatcctgctgcctctggtc
tcgtttctgctcctcaccactgtcttcgtctacacctggaagagccacccctctctctgc
agaaagctgggatccctgctcaagaggcacccagagggagaggaatcaaatcctgctgat
ggaaactgggagcccccaaggttcaacacacatgttcctgacctggtaaagccacttctg
cccgcccctggagacttggctctggcctccggcggcgtcccagcgaacccgggtttggag
gaagaggtgctccaacagcagagtcccctgagccaggccagggacctggatgctgagccc
ccagaacaaggccaggtggcccctggcaccaacggcattcatgtcaccggcgggtctgtg
acggtcaccgccccccgccctcccgggctttccatgccctaccaggaggatggcaaggct
tggcacctggctgagacagagacactggggtgctacgccctctga

DBGET integrated database retrieval system