KEGG   Bos mutus (wild yak): 102286579
Entry
102286579         CDS       T02919                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle 20
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
bom  Bos mutus (wild yak)
Pathway
bom04110  Cell cycle
bom04114  Oocyte meiosis
bom04120  Ubiquitin mediated proteolysis
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102286579 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102286579 (CDC20)
   04114 Oocyte meiosis
    102286579 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102286579 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286579 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102286579 (CDC20)
   03036 Chromosome and associated proteins [BR:bom03036]
    102286579 (CDC20)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     102286579 (CDC20)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    102286579 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 102286579
NCBI-ProteinID: XP_014334482
UniProt: L8IHD7
LinkDB
Position
Un
AA seq 499 aa
MAQFVFESDLHSLLQLDTPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKLQTTPSKPGGDRYIPHRNASQMEVASFLLSKENQPDNSETPTKKEHQKAWALNL
NGFDMEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASTGDILQLLQMEQPGDYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLCWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcccagttcgtgttcgagagtgacttgcactcgctgctgcagctggatacacccatc
cccaatgcaccccctgcgcgctggcagcgcaaagcgaaggaagccgcggggccggccccc
tcgcctatgcgggcagccaaccgatcccacagcgccggcaggaccccaggccgaactccc
ggcaaatccagctccaagcttcagaccactcccagcaaacctggcggtgaccgctatatc
ccccatcgcaatgcttcccagatggaggtggctagcttcctcctgagcaaggagaaccag
cctgacaacagtgagacgcccaccaagaaggaacatcagaaagcatgggctttgaatctg
aacggttttgacatggaggaagccaagatccttcggctcagtggaaaaccacaaaatgcc
ccagagggttaccagaacagactaaaagtactctatagccagaaggccacgccgggctcc
agcaggaagacctgccgttacattccttccctgccagaccgcatcctggatgcccctgaa
atccggaatgactactacctgaaccttgtggattggagctctgggaatgtgctggctgtg
gctttggacaacagtgtatacttgtggagtgctagcactggtgacattttgcagctgctg
caaatggagcagcctggggactatatatcttctgtggcctggatcaaagagggcaactac
ctggctgtgggcaccagcagtgccgaggtgcagctatgggatgtgcaacagcagaaacgg
cttcgaaacatgaccagtcattctgcccgagtgggctccctctgttggaatagctatatc
ctgtccagtggctcgcgctccggccacatccaccaccatgacgttcgggtagcggaacac
catgtggccacgctgagtggccacagccaggaagtgtgtgggttgcgctgggccccggat
ggaaggcatctagccagtggcggcaacgacaatctggtcaacgtgtggcctagtgctcct
ggagagggcggctgggttcctctgcagaccttcacccagcatcaaggggctgtcaaggct
gtagcttggtgtccctggcagtccaacgtcctggcaactggcgggggcacaagtgaccga
cacattcgtatctggaacgtctgctctggggcctgtctgagtgctgtggatgcccattcc
caggtgtgctccatcctctggtctccccactacaaggagcttatctcaggccacggcttt
gcccagaaccagctggttatttggaagtacccaaccatggccaaggtggctgagctgaaa
ggtcacacagcccgggtgctcagtctgaccatgagcccagatggggctacagtggcatcc
gcagcagcagatgagaccctgcgactgtggcgctgctttgagctggaccctgcccggcgg
cgggagcgggagaaggccagcgcggccaaaagcagcctcatccaccaaggcatccgctga

DBGET integrated database retrieval system