KEGG   Bos mutus (wild yak): 102287083
Entry
102287083         CDS       T02919                                 

Gene name
MAD1L1
Definition
(RefSeq) MAD1 mitotic arrest deficient like 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04110  Cell cycle
bom04114  Oocyte meiosis
bom04914  Progesterone-mediated oocyte maturation
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102287083 (MAD1L1)
   04114 Oocyte meiosis
    102287083 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102287083 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102287083 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102287083 (MAD1L1)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     102287083 (MAD1L1)
SSDB
Motif
Pfam: MAD
Other DBs
NCBI-GeneID: 102287083
NCBI-ProteinID: XP_005887388
LinkDB
Position
Un
AA seq 1625 aa
MEDLGENTTVLSTLRSLNNFISQRVEGGSGLDVSTSAQGSLQTQYQQSMQLEERAEQIRS
KSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAEA
QEKMKEQLERHRLCQQSLDAAGRKLREKEDGLAEAGETITTLKGRLSDLQWSVMNQEMQV
KRLESEKQELKEQLDLQHQKWQEANQKVQELQASQEVRADQEQRIKDLEQKLSLQEQDAA
IVKNMRSELVRLPTMERELRQLREENACLRETQDTNGLLREELEGLQRRLGRQEKMQETL
VDLELEKERLLTKLQSWERLDQTTGLSIRTPEDLSRFIVELQQRELALKDRNSAITSSAR
ELEKARLQLQDEVRQLGGQLLEERKRRETHEALARRLQKRSAALQRERDGMRAILGSYDS
ELTPAEHSPQLTRRMREAEDMMQKVQAHSSEVEAQLSQALEELGGQKQRADMLEMELKIL
KSQAAPAEQSFLFSREEVSSLRLKVEELEAERSRLEEEKKTLEAQLERLTLQGDYDQSKT
KPTQEPGHGPLGDGGPGLQSSTVSVRRPAAPEVPKAGSQADSRSITASQGGSCQAQLPAL
GLKRLAVGRSLAPPEHSPCSRAWRGSTGISVWSRALPVPCPRDRGRSPSSLQAPTVDLGV
QPAFLEAPGQQSLSCEPVEAGGRPSTGLRAWRPWSAVAVTRASLAVLQGCAPRRTPPSAA
FLRPDVGLVMVTVGVMLRMVSRVTAQQTPSRAVCIRLSAQDSGNGATQLGSELGRTGLPG
GPWPEPPAWISTSRDVSAEHRAQAAMGHQTALALSLASFNSRPCSRRQRGLLGSSDGVSS
TRVDLKSTVVASDGADVEPEPTEGGSGRRLREGPVGFLPSSFPDLELVNLWPESTAALPL
SMETADDQRPGLLKGSGATCGRGFKVPRAPGPLLPSAAGPCRETGVQATFLRWGPGHGPS
SQGPGGVGSSPCLLTESGPEGGHCCPGRCPELLGGGYRLQHGFSRAEEEPCRSLDVSRAP
EPRRTRRGWRQHSPGGAGHMYVHTKTRECHSLEAGKKAFWRRTGRRPRSVQTVEHHPALR
TNEPPIHKKDMEETSMPMTERKEPVGKDDRPCDWRHDGLGRAERWRREDEGRWGARWSPG
SVQGEDAVLCTTGRLHVRRYTFGQTHRRHGLQVSVSAPPTAPSASGSVAGLWALAELQPP
GLRSSGGSREGALLPLLGAPRQALQKLCHLGGAPEDLPPCPRWVDHVVLALQLFVVGDLS
RGGGWAEIIFVQGDKLLAEGPGLMAERLFGALWRQEAPASESGSWPLVAEASSRDAPPPI
RSAQPPRAFTTIVSGTEALLECLWSPRAAMMAVGGVLGRRPPHSPPQPDTEISSLPHDQR
PPHSPHDQTQRDPLSAPLKAQRAGEALSGCAGQQGWRETVPTTDVSPGSILSVAGPQAAG
GSSHPPACGVCWWENRPRLHTAGFPLTARLRASGVRELMGGAACVLVNALLPLSVLLRPQ
GADCLSLPTELKKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQVDITTESQYRLTS
MYAEQKADCLIFKAAGPSGTKMQLLETAFSRTVPGLIELHLLRQDSIPAFLSALTLDLFS
RQTVA
NT seq 4878 nt   +upstreamnt  +downstreamnt
atggaagacctgggggagaacaccaccgtcctgtccaccctgaggtctttgaacaacttc
atttctcagcgagtggagggaggatctggactggatgtttccacctctgctcaaggttct
ctgcagacgcagtaccagcagagcatgcagttggaggagcgagcagagcagatccggtct
aagtctcacctcatccaggtggagcgggagaagatgcagatggagctgagtcacaagagg
gctcgtgtggagctggagcgggcggccagcaccagcgccaggaactacgagcgcgaggtg
gaccgcaaccaggagctcctgacgcgcattcggcagcttcaggagcgggaggcggaggcg
caggagaagatgaaggagcagctggagcggcacaggctgtgccagcagagcctggacgcc
gccggcaggaagctgcgggagaaggaggacggcctggccgaggccggggagaccatcacc
acgttgaaggggaggctctcggacctgcagtggagcgtgatgaaccaggagatgcaggtc
aaacgcctggagtctgagaagcaggagctgaaggagcagctggacctgcagcaccagaaa
tggcaggaagctaaccagaaggttcaggagctccaggccagccaagaagtgcgagcagac
caggagcagaggatcaaggatttggagcaaaagctgtccctgcaggagcaggacgctgcg
attgtgaagaacatgaggtctgagctggtgcggctgccaacgatggagagggagctgcgg
cagctgcgggaagagaacgcctgcctgcgggagacgcaggacaccaacgggctgctgcgg
gaggagctggaggggctgcagcgcaggctggggcggcaggagaagatgcaggagacgctg
gtggacctcgagctggagaaggagaggctcttgacaaagctgcagagctgggagaggctg
gaccagaccaccggcttgagcatcaggacgccagaggacctgtctaggttcattgtggag
ctgcagcagcgcgagctggccttgaaggacaggaacagtgccatcaccagcagtgcccgg
gagctggagaaggcccgactgcagctccaggacgaggtccgccagctcggtggccagctg
ctggaggagaggaagcggcgcgagacgcatgaggccctggcgcggcggctgcagaagaga
tcagcggctctgcagagggagcgcgacggcatgcgggccatcctgggctcgtacgatagc
gagctgacccctgctgagcactcgcctcagctgacccgccgcatgcgcgaggccgaggac
atgatgcagaaggtgcaggcgcacagctcggaggtggaggctcagctgtcacaggcgctg
gaggagctgggaggccagaagcaaagagccgacatgctggagatggagctgaagatactg
aagtcacaggcggccccggctgagcagagcttcctattctccagggaggaggtgagctca
ctcaggttgaaggttgaggagctggaagccgagcggagtcgcctagaggaggagaagaag
acgctggaggcgcagctggagcggctcacactgcagggcgactacgaccagagcaagacc
aagcccacgcaggagccaggccacgggcctctgggggatgggggccctggcctgcagagc
agcacagtgagcgtgcgccggcctgctgcacccgaggtccccaaggccggctctcaggca
gacagcaggtccatcaccgcctcgcagggaggaagctgccaggcgcagctgcctgccctg
ggcctcaagcggctggcggtggggcgctccctggcccccccggagcacagcccctgctcc
cgtgcttggagagggagcacaggcatctccgtctggagccgggctctgcctgtgccctgt
ccccgggatcgtggacgcagcccctccagcctacaagctcccactgtcgacctcggcgtg
cagccagcctttcttgaggcgcctggtcagcagtcactgtcctgtgagcccgtggaggcg
ggaggcaggcccagcaccggcctgcgggcctggaggccttggtcggccgtggctgtgact
agagcgagcctggccgttctgcagggctgcgctccacgccgcacccctccttcagccgct
ttcctgcgaccggacgtggggctggtgatggtgaccgtgggtgtcatgcttcgcatggtc
agcagagtcacagcccagcaaacgccttcccgggctgtctgcatccgcctcagcgcccag
gactctggcaacggggccacgcagctgggctctgagctggggaggacggggctgccgggg
ggcccctggccagagccaccggcctggattagcactagccgggacgtcagtgctgagcac
agggcccaggcagccatgggtcaccaaactgcgttggcattgtcactggcatccttcaac
tcccggccttgcagcaggcggcagagaggcctgctggggtcttcagatggggttagcagc
acgagggtggatctgaaaagcaccgtggtggcttcggatggagctgacgtggaacccgag
cccacagagggtgggtcaggtcggcgccttcgtgaagggccggtgggtttccttccttcc
tctttcccagacctggaacttgtgaacctgtggcccgaatccaccgctgccctgccactt
agcatggagacagccgacgaccagcgtccggggctccttaaaggctcaggggccacgtgc
gggagaggcttcaaggtccccagggcgccaggccctctgctgccgtctgctgccgggcca
tgtcgggaaacgggggtccaggccaccttcctccgctgggggcccggacacgggccctcg
agccaggggcctggaggcgtggggagctcaccgtgcttgctgacggagtctgggcccgag
ggtgggcattgctgccctggccgctgcccagagctgctaggcggtggttaccgcctccag
catggcttctccagagccgaagaggagccctgcaggagcctggacgtcagcagagcccct
gagcccaggcgcacccggagggggtggcgccagcattcacctggaggagcaggacacatg
tatgtccacacgaaaacccgcgagtgccacagcctggaggcaggcaagaaggccttctgg
aggcgaacagggcgcagaccacgctccgtccagacagtggagcatcatccggcactgaga
acaaatgagccgccaattcacaagaaagacatggaggaaacttccatgcccatgactgag
cgcaaggagccggtcgggaaagacgacagaccatgtgactggcggcacgacggtctgggg
agggcggagcggtggagacgggaggatgaggggcgttggggggcgaggtggagcccaggg
agcgttcagggcgaggacgctgtcctctgcaccactgggaggctgcatgttcgccgttac
acgttcgggcagacccacaggcggcacggcctccaagtgagcgtgtccgcgccccccaca
gccccgtcggcctctggctctgtcgctgggctctgggccctcgctgagctgcagccacca
gggctgcgttcctctgggggctccagggagggtgctcttctgccgctgctgggtgcccca
cggcaggcgctccaaaagctctgccaccttgggggcgccccagaggacctccctccctgc
cctcgttgggtggatcatgtggtgctggcgctgcagctgttcgtagtcggggacctctct
agaggtgggggctgggcggagatcatttttgtgcaaggtgacaagctgcttgccgagggg
cctggactcatggcggagagactgttcggggccctctggcggcaggaggctccggccagc
gagtctgggtcctggccccttgtcgctgaagccagcagcagggatgcgccccctcccatc
cggagcgcccagccgcccagggctttcaccaccattgtctcagggacagaagcccttttg
gagtgcctgtggtcgcctcgcgctgccatgatggctgtgggcggcgtcctgggaaggaga
ccccctcactccccgccacaaccagacacagagatctcctcactcccccacgaccagaga
ccccctcactccccccacgaccagacacagagagaccccctcagtgcgcccctcaaggca
cagagagctggggaggccctctctggctgtgctggtcagcagggctggagggagaccgtc
cccaccacggatgtgtctcctgggagcatcttgtccgtggcaggtccccaggcagcaggt
ggctcgagtcacccgcctgcttgtggggtctgttggtgggagaacaggccacgtctgcac
acagcgggcttccccctcacggccaggttgcgtgcgtccggcgtccgagagctcatgggc
ggtgcagcctgtgtcctggtcaacgcgctgctgcccctgagtgtcctcctgagaccccag
ggagctgactgcctctccctccccacagagctgaagaagcaggtggagagtgcagagctg
aagaaccagcggctgaaggaggtcttccagaccaagatccaggagttccggaaagtgtgc
tacacgctgacgggctaccaggtggacatcaccacggagagccagtaccggctgacctcc
atgtacgccgagcagaaggccgactgcctcatcttcaaggccgcaggcccctcgggcacc
aagatgcagctgctggagacggcgttctcgcggacggtgccagggctcatcgagctgcat
ctgctgcggcaggacagcatccctgccttcctcagcgccctgaccctcgacctcttcagc
cgccagacggtggcctag

DBGET integrated database retrieval system