KEGG   Bos mutus (wild yak): 102287427Help
Entry
102287427         CDS       T02919                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04062  Chemokine signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04371  Apelin signaling pathway
bom04713  Circadian entrainment
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04727  GABAergic synapse
bom04728  Dopaminergic synapse
bom04810  Regulation of actin cytoskeleton
bom04926  Relaxin signaling pathway
bom05032  Morphine addiction
bom05034  Alcoholism
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102287427 (GNG12)
   04010 MAPK signaling pathway
    102287427 (GNG12)
   04371 Apelin signaling pathway
    102287427 (GNG12)
   04151 PI3K-Akt signaling pathway
    102287427 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102287427 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102287427 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102287427 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    102287427 (GNG12)
   04727 GABAergic synapse
    102287427 (GNG12)
   04725 Cholinergic synapse
    102287427 (GNG12)
   04728 Dopaminergic synapse
    102287427 (GNG12)
   04726 Serotonergic synapse
    102287427 (GNG12)
   04723 Retrograde endocannabinoid signaling
    102287427 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102287427 (GNG12)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    102287427 (GNG12)
  09164 Substance dependence
   05032 Morphine addiction
    102287427 (GNG12)
   05034 Alcoholism
    102287427 (GNG12)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    102287427 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102287427 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102287427 (GNG12)
   04031 GTP-binding proteins [BR:bom04031]
    102287427 (GNG12)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102287427 (GNG12)
  Exosomal proteins of colorectal cancer cells
   102287427 (GNG12)
GTP-binding proteins [BR:bom04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102287427 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 102287427
NCBI-ProteinID: XP_005895838
UniProt: L8IJ59
LinkDB All DBs
Position
Un
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRMEASIERIKVSKASADLMSYCEEHARNDPLLMGIPTSE
NPFKDKKTCTIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagacagccagtaccaacaacattgcccaggcacggaggactgtgcagcag
ttgagaatggaagcctccattgagagaataaaggtttcaaaggcatcagcagacctcatg
tcctactgtgaggaacatgccaggaatgaccctctgctgatggggataccaacttcagaa
aaccccttcaaggataagaagacctgcaccatcttatag

DBGET integrated database retrieval system