KEGG   Bos mutus (wild yak): 102287527Help
Entry
102287527         CDS       T02919                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bom  Bos mutus (wild yak)
Pathway
bom03030  DNA replication
bom03410  Base excision repair
bom03420  Nucleotide excision repair
bom03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102287527 (LIG1)
   03410 Base excision repair
    102287527 (LIG1)
   03420 Nucleotide excision repair
    102287527 (LIG1)
   03430 Mismatch repair
    102287527 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bom03032]
    102287527 (LIG1)
   03400 DNA repair and recombination proteins [BR:bom03400]
    102287527 (LIG1)
Enzymes [BR:bom01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102287527 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102287527 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102287527 (LIG1)
DNA replication proteins [BR:bom03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102287527 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102287527 (LIG1)
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102287527 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102287527 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102287527 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 PucR DDR
Motif
Other DBs
NCBI-GeneID: 102287527
NCBI-ProteinID: XP_014333607
LinkDB All DBs
Position
Un
AA seq 919 aa AA seqDB search
MQRSIMSFFQPKKEGKAKKPEKETSKSIRETESPPKVALKERNRVVSEGDSPVKRPGRKA
TRVLGSEGEEEEEEAPTTPRSQKPASDSPQASPPSPVTLPESSPSRSKPSPAVASPSGIP
KRRTARKQLPKRTFQDVLKEQGEDKDPETKKKKEEEETETPTESLPEPEGGDKEEVEGGD
QPMTPPEPRKTSSESESPTESVSEPGVTVKQEPQEDGQAQPPPKTPKTLSSFFSPRKPAV
KKEAKEEGPGALRKDETKGHVDPASYNPAKNNYHPIEDACWEAGQRVPYLAVARAFEKIE
EVSARLRMVETLSNLLRSVVALSPADLLPVLYLSLNRLGPPQQGLELGIGEGILLKAVAQ
ATGRQLESVRAEVAEKGDVGLVAESSRSTQRLVLPPPALTAAGVFAKFRDIAQLAGSAST
TKKIDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPSQECPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLEQIVPVLLEHGLERLPEHCRLSPGVPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSXXXXXXXHPAIG
SRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDL
IYLNGESLSLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDSEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRYGGFLL
ASYDEESEEFQAICKLGTGFSDEELEEHHQRLQALVLPTPRSYVRADGAVAPDHWLDPSD
VWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEQATTSAQVAGLYKKQ
SQIQNQQGAEPDSEQEEFY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccagcccaagaaagagggcaaagcgaagaagccg
gagaaggagacatccaagagcatcagagaaacggagtcccctccgaaggtggcgctgaag
gagcggaatcgagtggtgtctgagggtgactctccagtgaagaggccagggaggaaggcg
acccgggtcctgggcagcgagggcgaggaggaggaagaggaagcccccaccacccccaga
agccagaagcctgcttcagactctccacaggcctcgcctcccagtcctgtcacactgcct
gagagcagcccttcccgctccaaaccctccccagcagttgcatccccatcagggatcccg
aagcgtcgcacggcccggaagcagcttcccaaacggacatttcaagatgtcctgaaagag
cagggcgaggacaaggacccagaaactaagaagaagaaggaggaagaagaaacggagaca
ccaacagaaagcctcccagagcctgaagggggcgacaaggaggaagtggaaggcggggac
cagcccatgacgccccctgagccccggaagacctccagtgagtcagagtccccgacagaa
agcgtatcagagcctggggtgacggtgaagcaggaaccacaggaggatggccaggctcaa
ccgccccccaaaactccaaagaccctcagcagtttcttctccccccggaagccagctgtc
aaaaaagaagcgaaagaagaaggacctggtgctctgagaaaggacgagaccaagggacac
gtggacccagcgagctataatcctgccaagaacaactaccaccccatcgaagatgcctgc
tgggaggcgggccagagggttccttatctggctgtggcccgggcgttcgagaagatcgag
gaggtctctgctcggctccggatggtggagacgctgagcaacctgctgcgctccgtggtg
gccctgtcacctgctgacctcctgcccgtcctctacctgagcctcaaccgcctggggccg
ccccagcagggcctggagctcggcatcggagagggcatcctcctcaaggcagtggcccag
gccacgggtcggcagctggagtccgtccgggccgaggtggccgagaagggtgatgtgggg
ctggtggccgagagcagccgcagcacccagaggctcgtgctgcccccgcctgcgctcact
gccgccggcgtcttcgccaagttccgggacatcgcacagctggcaggcagcgcttccaca
accaagaagattgacgtcatcaaaggcctctttgtggcctgccgtcactcagaggcacgt
ttcattgccagagccctgagtggacggctgcgcctcgggttggctgagcagtcggtgctg
gcggccctcgcccaggccgtgagcctcacgccccccagtcaagaatgcccccccgccgtg
gtggacgccgggaagggcaagacggcagaagccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagactttctgtgaggtacctgacctggagcagatcgtccccgtgctt
ctggaacacggcctggagcggctcccggagcactgcagactgagcccaggggttcccctg
aaaccaatgttggcccaccctacccggggtgtcagtgaggtcctgaagcgctttgaggag
gcagctttcacctgcgagtacaaatacgacgggcagagggcacagatccatgttctggaa
ggcggggaggtgaagatcttcagcnannnnnnnnnnnnnnnnnggcacccggccattggc
agccgcatccctaagattaaactcccatcggtcacatccttcatcctagacacagaagct
gtagcttgggaccgggaaaagaagcagatccagccattccaagtcctcaccacccgcaaa
cgcaaggaggtggacgcggcggagatccaggtgcaggtgtgtctgtatgccttcgatctc
atctacctcaacggagagtccctgtccctggtacgtgagcccctctcccgacgccggcag
ctgctccgggagaacttcgtggagacggagggcgagttcgtctttgccacctccctggac
accaaggactcggagcagatcgccgagttcttggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggacgtggacgccacctacgagatcgccaagaggtcacac
aactggctcaagctgaagaaggactacctcgagggtgtgggcgacaccctggacctcgta
gtgattggtgcctacctgggcaaggggaaacgggccggccggtacgggggcttcctgctg
gcctcgtacgacgaggagagcgaggagttccaggccatctgcaagctcggaactggcttc
agtgacgaggagctggaagagcatcaccagaggctccaggccttagtgctgcccaccccg
cgctcctacgtccgggctgacggtgcggtggcccccgaccactggctggaccccagcgac
gtgtgggaggtgaagtgcgcggacctctccctgtcccccatctaccctgcggcccgaggc
ctggtggacagcgagaaggggatctccctccgcttccctcggtttattcgcgtccgtgag
gataagaagccggagcaggccactaccagtgcccaggtggccggtctgtacaagaagcag
agtcagattcagaaccagcagggtgcggagccggactccgagcaggaagagttctactag

DBGET integrated database retrieval system