KEGG   Bos mutus (wild yak): 102287858Help
Entry
102287858         CDS       T02919                                 

Gene name
EZH2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00310  Lysine degradation
bom05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102287858 (EZH2)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    102287858 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102287858 (EZH2)
Enzymes [BR:bom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102287858 (EZH2)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102287858 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     102287858 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET preSET_CXC
Motif
Other DBs
NCBI-GeneID: 102287858
NCBI-ProteinID: XP_014337505
LinkDB All DBs
Position
Un
AA seq 618 aa AA seqDB search
MGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDP
DEREEKQKDLEESREDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLP
GALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKCSYSFHATPNTYKR
KNTETALDNKPCGPHCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTP
TINVLESKDTDSDREAGAETGGESNDKDEEEKKDETSSSSEANSRCQTPIKMKPNTEPPE
NVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSVIAPAPAEDVDTP
PRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQ
CSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQR
GSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFN
LNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRY
SQADALKYVGIEREMEIP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgaagttttagaccaggatgggacgttcattgaagaactaataaaaaattat
gatggaaaagtacacggggatagagaatgtgggtttataaatgatgaaatttttgtggag
ctggtgaatgctcttggtcagtacaatgatgatgatgacgatgatgacggagatgatcct
gatgaaagagaagaaaaacagaaagatctagaggagagtcgagaagataaagaaagccgt
ccacctcggaaatttccttctgataaaatttttgaagctatttcctcaatgtttccagat
aagggcacagcagaagagctaaaggaaaagtacaaagaactcacggagcagcagctccca
ggtgcgcttcctcctgagtgcacccccaacatagatggaccaaacgccaagtctgtccag
agggagcagagcttgcattcgtttcatacgcttttctgtaggcgatgttttaaatatgac
tgcttcctacatcgtaagtgcagttattcttttcatgcaacacccaacacttacaagcga
aagaacacagagacggccctcgacaacaagccttgtggcccccactgttaccagcacttg
gagggagcgaaggagttcgctgcggctctcaccgccgagcggatcaagacccccccgaag
cgcccggggggccgccggagaggccggcttcccaacaacagcagcaggcccagcaccccc
accatcaacgtgctggagtcgaaggacacggacagcgaccgggaggcgggggccgagact
ggcggggagagcaacgacaaggacgaggaggagaagaaggacgagacctcaagctcctcg
gaagcgaattctcggtgtcaaacgccaataaagatgaagcccaacacggagccccccgag
aatgtggagtggagcggcgctgaggcctccatgttcagggtcctcatcggcacctactat
gacaatttctgtgccatcgccaggctcatcgggaccaaaacatgtcgacaggtgtatgag
tttcgagtcaaagaatccagtgtcatcgcgccggcccctgccgaggacgtggacactcct
ccccgaaagaagaagaggaaacaccggttgtgggccgcacactgcagaaagatccagctg
aagaaggacggctcctccaaccacgtttacaactatcaaccctgtgaccacccgcggcag
ccttgcgacagctcgtgcccttgtgtgatagcacagaatttttgtgaaaaattttgtcag
tgtagttcagagtgtcagaaccgctttcctggctgccgctgcaaagcccaatgcaacacc
aagcagtgcccgtgctacctggctgtccgcgagtgcgaccccgacctctgtctcacctgc
ggcgcggccgaccactgggacagcaagaacgtgtcctgcaagaactgcagcatccagcgg
ggctccaagaagcatttactgttggcaccgtctgatgtcgcaggctgggggatcttcatc
aaggatcctgtacagaaaaatgaattcatctcggaatactgtggagagattatttctcaa
gatgaagcagacagaagagggaaagtgtatgacaagtacatgtgcagctttctgttcaac
ttgaacaacgattttgtggtggatgcaacccgcaagggtaacaagattcgttttgcaaat
cactcagtaaatcccaactgctatgcaaaagtgatgatggtcaacggcgatcacaggata
gggatttttgctaagcgagccatccagactggtgaagagctgtttttcgattacagatac
agccaggccgacgccctgaagtacgtgggcatcgaaagagaaatggagatcccttga

DBGET integrated database retrieval system