Bos mutus (wild yak): 102287919 Help Entry 102287919         CDS       T02919                                  Gene name IL6 Definition (RefSeq) interleukin 6   KO K05405   interleukin 6 Organism bom  Bos mutus (wild yak) Pathway bom01521   EGFR tyrosine kinase inhibitor resistance bom01523   Antifolate resistance bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04066   HIF-1 signaling pathway bom04068   FoxO signaling pathway bom04151   PI3K-Akt signaling pathway bom04218   Cellular senescence bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04623   Cytosolic DNA-sensing pathway bom04625   C-type lectin receptor signaling pathway bom04630   JAK-STAT signaling pathway bom04640   Hematopoietic cell lineage bom04657   IL-17 signaling pathway bom04659   Th17 cell differentiation bom04668   TNF signaling pathway bom04672   Intestinal immune network for IgA production bom04931   Insulin resistance bom04932   Non-alcoholic fatty liver disease bom04933   AGE-RAGE signaling pathway in diabetic complications bom05010   Alzheimer disease bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05134   Legionellosis bom05135   Yersinia infection bom05142   Chagas disease bom05143   African trypanosomiasis bom05144   Malaria bom05146   Amoebiasis bom05152   Tuberculosis bom05161   Hepatitis B bom05162   Measles bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05166   Human T-cell leukemia virus 1 infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05168   Herpes simplex virus 1 infection bom05169   Epstein-Barr virus infection bom05171   Coronavirus disease - COVID-19 bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05321   Inflammatory bowel disease bom05323   Rheumatoid arthritis bom05332   Graft-versus-host disease bom05410   Hypertrophic cardiomyopathy Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102287919 (IL6)    04668 TNF signaling pathway     102287919 (IL6)    04066 HIF-1 signaling pathway     102287919 (IL6)    04068 FoxO signaling pathway     102287919 (IL6)    04151 PI3K-Akt signaling pathway     102287919 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102287919 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     102287919 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102287919 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102287919 (IL6)    04620 Toll-like receptor signaling pathway     102287919 (IL6)    04621 NOD-like receptor signaling pathway     102287919 (IL6)    04623 Cytosolic DNA-sensing pathway     102287919 (IL6)    04625 C-type lectin receptor signaling pathway     102287919 (IL6)    04659 Th17 cell differentiation     102287919 (IL6)    04657 IL-17 signaling pathway     102287919 (IL6)    04672 Intestinal immune network for IgA production     102287919 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102287919 (IL6)    05202 Transcriptional misregulation in cancer     102287919 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     102287919 (IL6)    05321 Inflammatory bowel disease     102287919 (IL6)    05332 Graft-versus-host disease     102287919 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     102287919 (IL6)    05020 Prion disease     102287919 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     102287919 (IL6)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     102287919 (IL6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102287919 (IL6)    04931 Insulin resistance     102287919 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     102287919 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     102287919 (IL6)    05135 Yersinia infection     102287919 (IL6)    05133 Pertussis     102287919 (IL6)    05134 Legionellosis     102287919 (IL6)    05152 Tuberculosis     102287919 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102287919 (IL6)    05161 Hepatitis B     102287919 (IL6)    05171 Coronavirus disease - COVID-19     102287919 (IL6)    05164 Influenza A     102287919 (IL6)    05162 Measles     102287919 (IL6)    05168 Herpes simplex virus 1 infection     102287919 (IL6)    05163 Human cytomegalovirus infection     102287919 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     102287919 (IL6)    05169 Epstein-Barr virus infection     102287919 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     102287919 (IL6)    05144 Malaria     102287919 (IL6)    05142 Chagas disease     102287919 (IL6)    05143 African trypanosomiasis     102287919 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102287919 (IL6)    01523 Antifolate resistance     102287919 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bom04052]     102287919 (IL6) Cytokines and growth factors [BR:bom04052]  Cytokines   Interleukins    102287919 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6 Motif Other DBs NCBI-GeneID:  102287919 NCBI-ProteinID:  XP_005901311 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MNSRFTSAFTPFAVSLGLLLVMTSXXXTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM VDKISAMRKEICEKNDECENSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNE WVKNAKIILILRNLENFLQFSLRAIRMK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaattcccgcttcacaagcgccttcactccattcgctgtctccctggggctgctcctg gtgatgacttcnnnnnnnnctaccccgggtcccctgggagaagatttcaaaaatgacacc accccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatg gtcgacaaaatctctgcaatgagaaaggagatatgtgagaagaatgacgagtgtgaaaac agcaaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacgga tgcttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctg gagtatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtc agggatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagat ctaataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgag tgggtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttc agcctgagagctattcggatgaagtag

DBGET integrated database retrieval system