KEGG   Bos mutus (wild yak): 102287919
Entry
102287919         CDS       T02919                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01523  Antifolate resistance
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom04659  Th17 cell differentiation
bom04668  TNF signaling pathway
bom04672  Intestinal immune network for IgA production
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05010  Alzheimer disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05134  Legionellosis
bom05135  Yersinia infection
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05332  Graft-versus-host disease
bom05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287919 (IL6)
   04668 TNF signaling pathway
    102287919 (IL6)
   04066 HIF-1 signaling pathway
    102287919 (IL6)
   04068 FoxO signaling pathway
    102287919 (IL6)
   04151 PI3K-Akt signaling pathway
    102287919 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102287919 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102287919 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102287919 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102287919 (IL6)
   04620 Toll-like receptor signaling pathway
    102287919 (IL6)
   04621 NOD-like receptor signaling pathway
    102287919 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102287919 (IL6)
   04625 C-type lectin receptor signaling pathway
    102287919 (IL6)
   04659 Th17 cell differentiation
    102287919 (IL6)
   04657 IL-17 signaling pathway
    102287919 (IL6)
   04672 Intestinal immune network for IgA production
    102287919 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287919 (IL6)
   05202 Transcriptional misregulation in cancer
    102287919 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102287919 (IL6)
   05321 Inflammatory bowel disease
    102287919 (IL6)
   05332 Graft-versus-host disease
    102287919 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102287919 (IL6)
   05020 Prion disease
    102287919 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102287919 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102287919 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102287919 (IL6)
   04931 Insulin resistance
    102287919 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102287919 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102287919 (IL6)
   05135 Yersinia infection
    102287919 (IL6)
   05133 Pertussis
    102287919 (IL6)
   05134 Legionellosis
    102287919 (IL6)
   05152 Tuberculosis
    102287919 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102287919 (IL6)
   05161 Hepatitis B
    102287919 (IL6)
   05171 Coronavirus disease - COVID-19
    102287919 (IL6)
   05164 Influenza A
    102287919 (IL6)
   05162 Measles
    102287919 (IL6)
   05168 Herpes simplex virus 1 infection
    102287919 (IL6)
   05163 Human cytomegalovirus infection
    102287919 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102287919 (IL6)
   05169 Epstein-Barr virus infection
    102287919 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102287919 (IL6)
   05144 Malaria
    102287919 (IL6)
   05142 Chagas disease
    102287919 (IL6)
   05143 African trypanosomiasis
    102287919 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102287919 (IL6)
   01523 Antifolate resistance
    102287919 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102287919 (IL6)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102287919 (IL6)
SSDB
Motif
Pfam: IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6
Other DBs
NCBI-GeneID: 102287919
NCBI-ProteinID: XP_005901311
LinkDB
Position
Un
AA seq 208 aa
MNSRFTSAFTPFAVSLGLLLVMTSXXXTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM
VDKISAMRKEICEKNDECENSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL
EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNE
WVKNAKIILILRNLENFLQFSLRAIRMK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaattcccgcttcacaagcgccttcactccattcgctgtctccctggggctgctcctg
gtgatgacttcnnnnnnnnctaccccgggtcccctgggagaagatttcaaaaatgacacc
accccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatg
gtcgacaaaatctctgcaatgagaaaggagatatgtgagaagaatgacgagtgtgaaaac
agcaaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacgga
tgcttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctg
gagtatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtc
agggatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagat
ctaataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgag
tgggtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttc
agcctgagagctattcggatgaagtag

DBGET integrated database retrieval system