KEGG   Bos mutus (wild yak): 102287943
Entry
102287943         CDS       T02919                                 

Gene name
PIM1
Definition
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287943 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287943 (PIM1)
   05206 MicroRNAs in cancer
    102287943 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102287943 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102287943 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102287943 (PIM1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102287943 (PIM1)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   102287943 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 102287943
NCBI-ProteinID: XP_005906846
LinkDB
Position
Un
AA seq 314 aa
MLLSKINSLAHLRAAPCSDLHATKLAPGKCLSPPNPGWRWGAAGPRGGGWGARGPPLRLS
DNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLI
LERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHDCGVLHRDIKDENILIDLNR
GELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIVRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQET
AEIHLHSLSPGPSK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcagcgacctg
cacgccaccaagctggcgccgggtaagtgcctctctccccccaaccctggatggaggtgg
ggggcggctggacctcgaggtgggggctggggggctcgcgggccgccactgaggctctcc
gacaacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggagag
ctgcctaatggcacccgagtgcccatggaagtggttctgctgaagaaggtgagctcgggc
ttctccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatc
ctggagaggccggagccggtgcaagacctcttcgactttatcacggaaaggggggctctg
caggaggagctggcccgcagcttcttctggcaggtgctggaggcggtgcgacactgccac
gactgcggggtgcttcaccgcgacatcaaggacgagaacatccttatcgacctcaatcgc
ggcgagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacacg
gacttcgatgggacccgagtgtatagtcctccagagtggatccgctatcatcgctaccat
ggcaggtcggcagccgtctggtctctggggatcctgctgtatgacatggtgtgcggagat
attccctttgagcacgatgaggagattgtcaggggccaagttttcttcaggcagcgggtc
tcctcagagtgtcaacatctcattagatggtgcttggccttgaggccatcagatcggcca
accttcgaagaaatccagaaccatccgtggatgcaagacgtcctcctgccccaggaaact
gctgagatccatctccacagcctgtcgccagggcccagcaaatag

DBGET integrated database retrieval system