KEGG   Bos mutus (wild yak): 102287968
Entry
102287968         CDS       T02919                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
bom  Bos mutus (wild yak)
Pathway
bom01523  Antifolate resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04920  Adipocytokine signaling pathway
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05340  Primary immunodeficiency
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102287968 (IKBKG)
   04014 Ras signaling pathway
    102287968 (IKBKG)
   04064 NF-kappa B signaling pathway
    102287968 (IKBKG)
   04668 TNF signaling pathway
    102287968 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102287968 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102287968 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102287968 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102287968 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102287968 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102287968 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102287968 (IKBKG)
   04660 T cell receptor signaling pathway
    102287968 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102287968 (IKBKG)
   04659 Th17 cell differentiation
    102287968 (IKBKG)
   04657 IL-17 signaling pathway
    102287968 (IKBKG)
   04662 B cell receptor signaling pathway
    102287968 (IKBKG)
   04062 Chemokine signaling pathway
    102287968 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102287968 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102287968 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287968 (IKBKG)
   05203 Viral carcinogenesis
    102287968 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102287968 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102287968 (IKBKG)
   05221 Acute myeloid leukemia
    102287968 (IKBKG)
   05220 Chronic myeloid leukemia
    102287968 (IKBKG)
   05215 Prostate cancer
    102287968 (IKBKG)
   05222 Small cell lung cancer
    102287968 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102287968 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102287968 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102287968 (IKBKG)
   05135 Yersinia infection
    102287968 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102287968 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102287968 (IKBKG)
   05162 Measles
    102287968 (IKBKG)
   05164 Influenza A
    102287968 (IKBKG)
   05161 Hepatitis B
    102287968 (IKBKG)
   05160 Hepatitis C
    102287968 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102287968 (IKBKG)
   05163 Human cytomegalovirus infection
    102287968 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102287968 (IKBKG)
   05169 Epstein-Barr virus infection
    102287968 (IKBKG)
   05165 Human papillomavirus infection
    102287968 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102287968 (IKBKG)
   05142 Chagas disease
    102287968 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102287968 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102287968 (IKBKG)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102287968 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 102287968
NCBI-ProteinID: XP_005910171
UniProt: A0A6B0SGU3
LinkDB
Position
Un
AA seq 419 aa
MSRPPWKSPLCEMVQPSGSPAGDQDMLGEESSLGKPAMLHVPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGNQREEKAFLMQKFQEARDLVVRLSLEKRELRQQREQ
ALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEK
ARQLESEREALEQRHSVQVDQLVLQNESMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHMKSSMVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQPPLAPGPAHHSFHLNPSSQRRSPPDEPPKFCCPKCQYQAPDIDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtccactgtgtgagatggtgcagccgagtggcagtccg
gcaggggaccaggacatgctgggtgaagagtcttctctggggaagccagccatgctccac
gtgccttcagagcagggcacccctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagacgccatccgccagagcaaccagatgctgcgcgagcgctgtgaggagctgcag
cgtttccagggcaaccagagggaggagaaggccttcctcatgcagaagttccaggaggcc
cgggacttggtggtgaggctgagcctggagaagcgtgaactgcgccagcagagggagcag
gccctgaaggaggtggagcgcctgaagacgtgccagcagcagatggctgaggacaaggcc
tcagtgaaagcccaggtaacgtccttgctgggggagctgcaagagagccagagtcgcttg
gaggctgccactaaggagcgccaggctttggagagcagggcccgggtggccagcgaaaag
gcccggcagctggagagcgagcgggaggcgctggaacagcggcacagcgtgcaggtggac
cagcttgttctgcagaacgagagcatggaagctgccctgcgcatggaacggcaggccgcc
tcagaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacaatcacatgaagagcagcatggtgagcagtgagcggaaccgaggactgcagctg
gaggatctcaagcagcagctccagcaggctgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaggaggcggaacagcacaagattgtgatggagactgtcccagtg
ctaaaagcccaggcggatatctacaaggcagacttccaggccgagaggcaggcccgggag
aagctggctgagaagaaggaattcctgcaagaacagctggagcagctgcagagggaatac
agcaggctcaagaccagctgtcaggagtcagccaggattgaagacatgaggaagcggcac
gttgaggtctcccagccccccttagcccctggcccagctcatcactcctttcacctgaac
ccgtccagccagaggagaagcccccctgacgagccgcccaagttctgctgccccaagtgt
cagtatcaggctcctgacatagacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system