KEGG   Bos mutus (wild yak): 102287995Help
Entry
102287995         CDS       T02919                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00590  Arachidonic acid metabolism
bom01100  Metabolic pathways
bom04611  Platelet activation
bom04726  Serotonergic synapse
bom04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102287995 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102287995 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102287995 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    102287995 (PTGS1)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102287995 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102287995
NCBI-ProteinID: XP_014333502
LinkDB All DBs
Position
Un
AA seq 600 aa AA seqDB search
MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDINALEFYLGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagggtatctcgctccgattcccgctgcttctcctgctgctgtcgccatcc
cccgtcttgccagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattctggccccaactgcaccatccctgagatatggacctggctccggacg
actttgcggcccagcccgtctttcgtccactttctgctgacgcatgggcgctggctgtgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcatgactacatcagctgggag
tccttctccaatgtgagttattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatgggcaccaaagggaagaagcagttgccagatgcggagtttctgagtcgtcgc
ttcctgctcaggaggaagttcatccccgaccctcaaggcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttctggcaagatgggtcctggcttc
accaaggcgttgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaaactcaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggctcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatgctc
tacgccacgatatggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
ccgacctggggtgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgtttggggcccaattccagtaccgcaaccgcatcgccatggag
ttcaaccagctctaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggatcggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatctcgggagctgaggctg
cagcctttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ctcacaggggagaaggagatggcagctgagttggaggagctgtatggagacatcaatgct
ttggaattctatctggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttagggaaccccatctgt
tctccagagtactggaaggcaagcacatttggtggtgacgtgggcttcaaccttgtcaag
acggccacgctgaagaagctggtttgcctcaacaccaagacttgtccctacgtctccttc
catgtgccagacccccatcgggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system