KEGG   Bos mutus (wild yak): 102288017
Entry
102288017         CDS       T02919                                 

Gene name
CCR3
Definition
(RefSeq) C-C motif chemokine receptor 3
  KO
K04178  C-C chemokine receptor type 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04062  Chemokine signaling pathway
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102288017 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102288017 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102288017 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102288017 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102288017 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102288017 (CCR3)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    102288017 (CCR3)
Cytokine receptors [BR:bom04050]
 Chemokine receptors
  CC Chemokine
   102288017 (CCR3)
CD molecules [BR:bom04090]
 Proteins
  102288017 (CCR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF4064
Other DBs
NCBI-GeneID: 102288017
NCBI-ProteinID: XP_005900954
UniProt: L8I938
LinkDB
Position
Un
AA seq 358 aa
MATSADGIETVGEVAGTTPYDYEAALPCEKSNVKELAAQFLPPLYSLVFVTGLLGNVVVV
VILTKYKRLRIMTNIYLLNLAISDVLFLFTLPFWIHYVRWNEWVFGHRMCKLLSGLYYMG
LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIVTSIFTWVLAGLAALPEFFFHETQE
EAGQTFCSPLYPEDNENAWKRFHALRMNILGLALPLLVMTICYSGIIKTLLRCPSKKKYK
AIRLIFVIMVVFFIFWTPYNLVVLLFAFQMHLKADCEQSRQLDLAMLVTEVIAYTHCCVN
PVIYAFVGERFRKHLRHFFHRYMATYLGKFMPFLPSEKLERTSSVSPSTGEQELSAVF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcgacctcagctgatgggattgaaactgtaggtgaagttgctgggaccacaccctac
gactatgaggcggcactgccgtgcgagaagagcaacgtcaaggagctggcggcccagttc
ctgcccccgctgtactccctggtgtttgtgaccggcctgctgggcaacgtggtggtggtg
gtgatactcacaaagtacaagcggctccggatcatgaccaacatctacctgctcaacctg
gccatttctgatgtgctcttcctattcacactgccattctggattcactatgttaggtgg
aacgagtgggtgtttggccaccgcatgtgtaagttgctctccgggctctattacatgggc
ttgtacagtgagatctttttcatcatcctcttgaccatagaccggtatcttgccatcgtc
cacgccgtgtttgcccttcgagcccggacagtcacttttggtattgttaccagcatcttc
acctgggtcctggcagggctagcagccctccctgaatttttctttcatgagacccaagag
gaggctggacagactttctgcagtcctctttacccagaggataatgaaaatgcctggaag
cgattccatgctctgagaatgaatatcctgggtctcgctctgcctctgcttgttatgacc
atctgctattcaggaattattaaaacactgctgagatgccccagtaaaaaaaaatataaa
gccattcgacttatttttgtaattatggtggtcttctttattttctggacaccctacaat
ctggttgtcctactctttgcttttcaaatgcacttgaaggctgattgtgaacagagcaga
cagctggacctggccatgctggtgacagaggtgatcgcctacacgcactgctgtgtcaac
cccgtgatctatgccttcgttggtgagaggttccggaagcacctccgccactttttccac
agatatatggccacctacctgggaaaattcatgccatttcttcctagtgaaaaactggaa
agaaccagctctgtctccccatcaacaggggagcaggaactctctgctgtattttag

DBGET integrated database retrieval system