KEGG   Bos mutus (wild yak): 102288078Help
Entry
102288078         CDS       T02919                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
bom  Bos mutus (wild yak)
Pathway
bom05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    102288078 (PARK7)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     102288078 (PARK7)
Peptidases [BR:bom01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   102288078 (PARK7)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102288078 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 102288078
NCBI-ProteinID: XP_005892755
UniProt: L8IPP3
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALKIVEVLVGKEVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaagagctctagtcatcctggctaaaggagcagaggaaatggagacggtt
atccctgtagatgtcatgagacgagctggaattaaggtcaccgttgcaggtctggctgga
aaagacccggtacagtgtagccgagatgttgtcatttgtcctgatgccagtctggaagat
gcaaaaaaagagggaccttatgatgtggtggttcttccaggaggtaatctgggtgcacag
aatttatccgagtccgctgctgtgaaggagatactgaaggaacaagagaagaggaagggc
ctcatcgctgccatctgtgcaggtcctacagctctgctggctcatgaaataggttttgga
agcaaagttacaacacacccacttgctaaagacaaaatgatgaacggaagtcattacagc
tactccgagaaccgtgtggaaaaggatggcctgatccttaccagccgggggccaggaacc
agctttgagtttgctctgaagatcgtcgaggtgctggttggcaaggaggtggccgaccaa
gtgaaggccccgctggttcttaaagattaa

DBGET integrated database retrieval system