KEGG   Bos mutus (wild yak): 102288212
Entry
102288212         CDS       T02919                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04141  Protein processing in endoplasmic reticulum
bom04151  PI3K-Akt signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04918  Thyroid hormone synthesis
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102288212 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102288212 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102288212 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102288212 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102288212 (ATF6B)
   04915 Estrogen signaling pathway
    102288212 (ATF6B)
   04926 Relaxin signaling pathway
    102288212 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102288212 (ATF6B)
   04918 Thyroid hormone synthesis
    102288212 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102288212 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102288212 (ATF6B)
   04927 Cortisol synthesis and secretion
    102288212 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102288212 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102288212 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102288212 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102288212 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102288212 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102288212 (ATF6B)
   05031 Amphetamine addiction
    102288212 (ATF6B)
   05034 Alcoholism
    102288212 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102288212 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102288212 (ATF6B)
   05161 Hepatitis B
    102288212 (ATF6B)
   05163 Human cytomegalovirus infection
    102288212 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102288212 (ATF6B)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102288212 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 102288212
NCBI-ProteinID: XP_005901676
LinkDB
Position
Un
AA seq 710 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGAQNSTLYAGLDEVAEEQTELFRCPEQDVPFGS
SSLDLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSNQAPGVGE
MLVVKSESLAPPLCLLGDDPTSPFETIQINVSTTSDDPSDIQIKIEPASPSSSINSEAPL
LSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPSPGAVQISMGLSSDGSSGKALPAR
KPPLQPKPMLITTVPIPPRAVPASTTVLLQPLVQPPPVSPVVLIQGTVRVQPEGPTPPPP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNREAACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIAFNFGPVSISEPP
PASISPRMSRGESRPRRHLLEFSAQEPVHGAEPRQHPFQDPEEPQPSPAGHPSFRNLTAF
PGDTRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQEKQKS
QLRKKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLYDSH
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactggggtgcgcagaacagcactttgtacgccggcttggatgaa
gtggccgaggagcagacggagctcttccgttgtccggagcaagatgtcccgtttggcagc
agctctctggacctgggaatggacgtcagccctcctgaacccccctgggactctctgcct
atcttcccagatctccaggtgaagtctgagccatcctccccctgctcttcctcctccctc
agctctgaatcatcgcatctttccacagagccctccaaccaggcccctggtgtaggggag
atgctggttgtgaagtcagagtccttggcacccccactctgcctcctgggagatgatcca
acatccccatttgaaaccatccagatcaatgtcagcaccacctctgatgatccttcagat
attcagattaagatagagcctgcctctccatcttcctccatcaactcggaggctcccctg
ctctctgcagagtcccccagccaggctttcataggagaggaggtcctggaagtgaagaca
gagtccccgtcccctcaggggtgtctcctgcgggatgtccccggcccctctcctggagct
gtccagatcagcatgggcctgtcctctgacggctcctcaggcaaagccctgcctgcccgg
aagccaccactgcagcccaaacccatgctgataaccactgtcccgatacccccgagagct
gtgcctgccagcaccaccgtcctcttgcagcctcttgtccagccacccccagtgtcccca
gttgtcctcatccaaggtactgttcgagtccagcctgagggaccgacccctcctcctcca
cggcctgagaggaagagcattgttccagcccctatgcctgggaactcctgccctcctgag
gtggatgccaagctgctgaagcggcagcagcggatgatcaagaaccgggaggcagcctgc
cagtcccgcaggaagaagaaagagtacctgcaggggctggaagcccggctgcaggccgtg
ctggccgacaaccagcagctccggcgggagaatgctgccctccgccggcggctggaggcc
ctgctgactgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcgtc
atggtcttccttctcttcatcgctttcaactttgggcctgtgagcatcagtgagcctcct
ccggcttccatctctcctcggatgagcagaggggagtctcgaccccggagacacttgctg
gagttctcggcacaagagccagttcatggagccgagccccgccagcatcccttccaggac
cctgaggagccccagcccagccccgctggccacccaagtttcaggaacctgacagccttc
cctggggacaccagggagctgctgctgagagacctggaccagctcttcctctcctcggat
tgccggcactttaaccgaaccgagtccctgaggcttgctgacgagctgagtggctgggtc
cagcgccaccagagaggccggcggaagacacctcagagagcccaggagaaacagaagtct
cagttgcggaagaagtctcctccagttcaggcagtccctacccgcccccctgggcccccg
gaaggggattccgtgggccagctgcagctgtaccgccaaccagaccgttcgcagcccgag
ttcctggatgcaattgaccgacgggaagacacattttacgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtg
atgcctgctatggcccccaatgagaccctatcaggccggggaccccctggggactatgag
gagatgatgcagatcgagtgtgaggtcatggatacgagggtgattcacatcaagacctcc
acagtgcccccctcgctacgaaaacagccgtcctcaaccccgggcaatgccacgggtggc
cccttgccagcttctgcagcagccagccaggctcaccaggctgcccatcagccctctacc
tcaatcatctctgacctctatgactcacactga

DBGET integrated database retrieval system