KEGG   Bos mutus (wild yak): 102288216
Entry
102288216         CDS       T02919                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04218  Cellular senescence
bom04270  Vascular smooth muscle contraction
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04613  Neutrophil extracellular trap formation
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04929  GnRH secretion
bom04935  Growth hormone synthesis, secretion and action
bom05010  Alzheimer disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05034  Alcoholism
bom05132  Salmonella infection
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102288216 (RAF1)
   04012 ErbB signaling pathway
    102288216 (RAF1)
   04014 Ras signaling pathway
    102288216 (RAF1)
   04015 Rap1 signaling pathway
    102288216 (RAF1)
   04370 VEGF signaling pathway
    102288216 (RAF1)
   04371 Apelin signaling pathway
    102288216 (RAF1)
   04630 JAK-STAT signaling pathway
    102288216 (RAF1)
   04068 FoxO signaling pathway
    102288216 (RAF1)
   04072 Phospholipase D signaling pathway
    102288216 (RAF1)
   04071 Sphingolipid signaling pathway
    102288216 (RAF1)
   04024 cAMP signaling pathway
    102288216 (RAF1)
   04022 cGMP-PKG signaling pathway
    102288216 (RAF1)
   04151 PI3K-Akt signaling pathway
    102288216 (RAF1)
   04150 mTOR signaling pathway
    102288216 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102288216 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102288216 (RAF1)
   04218 Cellular senescence
    102288216 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102288216 (RAF1)
   04540 Gap junction
    102288216 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102288216 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102288216 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102288216 (RAF1)
   04625 C-type lectin receptor signaling pathway
    102288216 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    102288216 (RAF1)
   04660 T cell receptor signaling pathway
    102288216 (RAF1)
   04662 B cell receptor signaling pathway
    102288216 (RAF1)
   04664 Fc epsilon RI signaling pathway
    102288216 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    102288216 (RAF1)
   04062 Chemokine signaling pathway
    102288216 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102288216 (RAF1)
   04929 GnRH secretion
    102288216 (RAF1)
   04912 GnRH signaling pathway
    102288216 (RAF1)
   04915 Estrogen signaling pathway
    102288216 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102288216 (RAF1)
   04917 Prolactin signaling pathway
    102288216 (RAF1)
   04921 Oxytocin signaling pathway
    102288216 (RAF1)
   04926 Relaxin signaling pathway
    102288216 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    102288216 (RAF1)
   04919 Thyroid hormone signaling pathway
    102288216 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    102288216 (RAF1)
   04916 Melanogenesis
    102288216 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102288216 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    102288216 (RAF1)
   04720 Long-term potentiation
    102288216 (RAF1)
   04730 Long-term depression
    102288216 (RAF1)
   04722 Neurotrophin signaling pathway
    102288216 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    102288216 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102288216 (RAF1)
   05206 MicroRNAs in cancer
    102288216 (RAF1)
   05205 Proteoglycans in cancer
    102288216 (RAF1)
   05230 Central carbon metabolism in cancer
    102288216 (RAF1)
   05231 Choline metabolism in cancer
    102288216 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102288216 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102288216 (RAF1)
   05212 Pancreatic cancer
    102288216 (RAF1)
   05225 Hepatocellular carcinoma
    102288216 (RAF1)
   05226 Gastric cancer
    102288216 (RAF1)
   05214 Glioma
    102288216 (RAF1)
   05221 Acute myeloid leukemia
    102288216 (RAF1)
   05220 Chronic myeloid leukemia
    102288216 (RAF1)
   05218 Melanoma
    102288216 (RAF1)
   05211 Renal cell carcinoma
    102288216 (RAF1)
   05219 Bladder cancer
    102288216 (RAF1)
   05215 Prostate cancer
    102288216 (RAF1)
   05213 Endometrial cancer
    102288216 (RAF1)
   05224 Breast cancer
    102288216 (RAF1)
   05223 Non-small cell lung cancer
    102288216 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102288216 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102288216 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    102288216 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102288216 (RAF1)
   05152 Tuberculosis
    102288216 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102288216 (RAF1)
   05161 Hepatitis B
    102288216 (RAF1)
   05160 Hepatitis C
    102288216 (RAF1)
   05164 Influenza A
    102288216 (RAF1)
   05163 Human cytomegalovirus infection
    102288216 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102288216 (RAF1)
   05165 Human papillomavirus infection
    102288216 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102288216 (RAF1)
   01522 Endocrine resistance
    102288216 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102288216 (RAF1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102288216 (RAF1)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102288216 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102288216
NCBI-ProteinID: XP_005902901
LinkDB
Position
Un
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGTSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDGGVPALPSLTMRRMRESVSRIPPGSQHRYSTPHAFTF
SASSPSSEGSLSQRQRSTSTPNVHMVSATLPVDSRMIEDAIRSHSESGSPSALSSSPNNL
SPTGWSQPKTPAPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggcgcctggaagacgatcagcaacggtttcggattcaaagacacg
gtgtttgacggcaccagctgcatctcccctacaatagttcagcaatttggctatcagcgt
cgggcgtcagatgatggcaaacttacggacccttctaagacaagcaacactatccgtgtg
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgcctcatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacggttagattggaatactgatgctgcctcg
ttgatcggagaggaacttcaagtggatttcctggatcatgttcccctcacaacacacaac
tttgctcggaaaaccttcctgaagcttgccttctgtgacatctgtcagaagttcttgcta
aatggatttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cccactatgtgtgtggactggagtaatatcagacagctcttattgttcccaaattccact
gttggtgatggcggggtcccagcgctgccttctttgacgatgcgtcggatgcgagagtct
gtttcccggatacctcctggttcccagcacagatattccacaccccacgctttcacattc
agcgcctccagcccctcctctgaaggctcgctctcccagaggcagaggtcgacgtccacg
cccaacgtgcacatggtcagcgccaccctgcctgtggatagcaggatgatcgaggatgca
attcgaagtcacagtgaatcaggctccccttcagccttgtccagcagtcccaacaatttg
agcccaacaggctggtcacagcccaaaacccctgcgcctgcacagagagagcgggcgcca
ggctccagcacccaggagaagaacaaaattaggcctcgtggacagagagattcgagctat
tactgggaaatagaagccagtgaagtgatgctgtccactcggattggatcaggctccttt
gggactgtttataagggcaagtggcatggagacgttgcagtaaagattctgaaggtcgtt
gaccccaccccagagcagttccaggccttcaggaatgaggtggctgtcctccgcaaaacc
cggcacgtgaacatcctgctctttatggggtacatgacgaaggacaacctggcgatagtg
acccagtggtgcgagggcagcagcctctacaaacacctgcacgtccaggagaccaagttc
cagatgttccagctgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaataatatatttctccatgaaggcctg
acggtgaaaatcggtgattttggattggccacggtgaagtcgcgctggagtggttctcag
caggtcgagcagcccaccggctccatcctgtggatggccccagaggtgatccggatgcag
gataataacccgttcagcttccagtccgacgtctactcctacggcatcgtgctgtatgag
ctcatgacgggggagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgcgggtatgcctccccagacctcagcaagctatacaagaactgccccaaagcc
atgaagaggctggtagctgactgcgtgaagaaagtgaaggaagaaaggcctctttttccc
cagatcctgtcttccatcgagctgctccagcattctctgcccaagatcaaccggagtgcc
tcggagccctccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcccctcggctgcctgtcttctag

DBGET integrated database retrieval system