KEGG   Bos mutus (wild yak): 106701212
Entry
106701212         CDS       T02919                                 

Gene name
RANBP1
Definition
(RefSeq) RAN binding protein 1
  KO
K15306  Ran-binding protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106701212 (RANBP1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106701212 (RANBP1)
SSDB
Motif
Pfam: Ran_BP1 DUF1681
Other DBs
NCBI-GeneID: 106701212
NCBI-ProteinID: XP_014336116
LinkDB
Position
Un
AA seq 156 aa
MRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMEL
KPNAGSDRAWVWNTHADFADECPKQELLAIRFLNAENAQKFKTKFEECRKEIEEKEKKGS
GKNDSTEKVVEKLEALSVQEGEQPQDAAPAAVEEEQ
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcgggccaagctgttccggtttgcttcagagaacgaccttccggagtggaaggagcgg
ggcacgggggacgtcaagctgttgaagcacaaggagaaggggaccatccgcctgctcatg
cgcagggacaagaccctcaagatctgcgccaaccactacatcacgccgatgatggagctg
aagccgaacgcaggcagcgaccgtgcctgggtctggaatacccatgccgactttgccgac
gagtgccccaagcaggagctcctggccatccgcttcctcaacgccgagaatgcacagaaa
tttaagacgaagtttgaagaatgcaggaaagagattgaagagaaagaaaaaaaagggtcc
ggcaagaatgacagcaccgagaaggtggtggagaagctcgaggcgctatcggtgcaggag
ggcgagcagccccaggacgcggccccggcggcagtcgaggaggagcagtga

DBGET integrated database retrieval system