KEGG   Bombella sp. KACC 21507: GT348_00825Help
Entry
GT348_00825       CDS       T06386                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bomb  Bombella sp. KACC 21507
Brite
KEGG Orthology (KO) [BR:bomb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT348_00825 (ahpF)
Enzymes [BR:bomb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GT348_00825 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored Glutaredoxin Thi4 HI0933_like FAD_binding_3 zinc_ribbon_9 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QHI95046
LinkDB All DBs
Position
174647..176212
Genome map
AA seq 521 aa AA seqDB search
MLTDDLKIQLRGYLQHIRQNISLESSLGDDSKSVEMRNFLIEISELSDKIIFKEGGTNKH
RPSFDIKRDRTDIGVTFAGIPLGHEFSSLILALLQVGGHPPKIEEAQKERILSLTGSYHF
ETYFSLSCHNCPDVVQALNTISVLNPAIRHTAIDGGLFPQEVEERDIRSVPQVFLNGEPF
STGRMDIEQILAKIDSAGIARAVESLNDEAPFDTLVVGSGPAGAAAAIYVARKGLRTGIV
AERFGGQVVDTSGIENFISVPETEGPLLAQNLEQHVRRYDIRIMGSQRAAQLVPAKEEGA
LHEVILENGAHLKARTIIIATGARIRSLNVPGEDDYRTRGVAYCPHCDGPFFKGRSIAVA
GGGNSGVEAAIDLAGIVSHVTLLQRSSVLKADQVLQDKLKTMPNVTVIKNAVTQKIVGDG
KKMSGLVWKNKEDGSEQQLDVEGLFVQIGLDPNSDWVKNVLEISPAGEIVIDERCRTTVP
GIFAAGDVTTVPYKQIVIAVGEGAKAALSAFDYMIRVPHKS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgatgacctaaaaatacaattaagaggctatctccaacatattcggcagaac
atttcgctcgagtcgtcccttggagatgactcaaaatcagtcgaaatgcgtaattttctt
atagaaatttccgaactctctgacaagataatttttaaagaaggcggtacaaacaagcac
cgtccgtcttttgacattaaacgtgacagaacggatataggggttacttttgcaggtatt
cccttaggccacgaattttcgtctctcattttggcgctcttacaggttggagggcatccg
cctaaaattgaagaggcccaaaaagagcgcattctttcgctgacaggtagctatcatttt
gagacctatttctcgctttcttgtcataactgcccagacgttgtgcaggctctcaacaca
ataagcgtcttaaatccggcaattcgtcacacagctattgatggtgggctatttcctcaa
gaagtagaagagcgtgatatacggtctgtgccacaggtctttctaaatggagaacctttc
tccacaggccggatggatattgagcaaattctagctaaaattgactctgccgggattgct
cgtgctgttgagtctcttaatgatgaggctccatttgatacccttgttgtggggtctggt
ccagccggggcagcagcagcgatttatgtcgcgcgtaaagggttgcgtacaggcatagtg
gcagagcgttttggtggccaggtcgtagacacatctgggattgagaattttatctctgtg
ccagagactgagggccctcttctagctcagaatttagagcagcatgtgcgtcgttatgat
attcgcattatggggtcgcaacgtgcagcgcagttggttcctgccaaagaagagggtgcc
ttacacgaggtcattttggaaaatggcgctcatttaaaggcacgtactatcattatagcg
acaggggcccgtatccgctctcttaatgtcccgggtgaagatgactaccggacacgtggc
gttgcttattgccctcactgtgatggtcctttctttaaaggacgctctattgctgttgct
ggaggaggaaatagcggcgttgaagcggctattgatctggcgggaatcgtgtctcacgtc
acgttgttgcagcgtagttcggttctcaaagctgaccaggtgttacaggataaacttaaa
accatgcctaatgtaacggttattaaaaacgccgtgacgcagaaaatcgtgggtgatggt
aaaaaaatgtctggtttggtctggaagaataaagaagacggctctgagcaacagctcgac
gtcgaaggcctatttgtccagatcggtctggatccaaactctgactgggtcaaaaacgtt
ttagagatttccccagccggtgagattgtgattgatgagcgatgccgcacaacggttcca
ggtatttttgccgctggtgacgtcacaacagtgccttataagcaaattgtcatagcggta
ggtgaaggtgcgaaggcagcattatcagcctttgattatatgattcgcgtacctcacaaa
agttaa

DBGET integrated database retrieval system