KEGG   Bacillus oceanisediminis: A361_00085
Entry
A361_00085        CDS       T04330                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00550  Peptidoglycan biosynthesis
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A361_00085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bon01002]
    A361_00085
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bon01011]
    A361_00085
Enzymes [BR:bon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A361_00085
Peptidases and inhibitors [BR:bon01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   A361_00085
Peptidoglycan biosynthesis and degradation proteins [BR:bon01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A361_00085
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Other DBs
NCBI-ProteinID: AND37656
UniProt: A0A160M5K8
LinkDB
Position
19824..21179
AA seq 451 aa
MKKTFYRKSIAGFLALVMILGLLPGIHKAHAEDILNINADAAILVDAETGKILYQKNADK
VLGIASMTKMMTEYLLLEAVEEGKVKWDQEYAVSEYVWKVSQDRNLSNVPLRRDGKYNIR
ELYEAMAIYSANGATIAIAETIAGSETNFVKMMNEKAAELGLKDYKFVNSSGLNNRDLKG
SPPAGGPEEENVMSAKDTAMLAKELINRFPEVLETASTPRKTFREGTDDEIKMENWNWML
PELVYGYEGADGLKTGTTDFAGYCFTGTAMRDGNRYISVVMNAKGANGQATYKSRFDETK
KMFDFGFSNFTKEEIVPANYQVKGHKTVPVTKGKEDKVKISSKDAIEMVVRNGEKENYKP
VLVIDKEKLNENGELTAPIKKGEKIGYLTIESKEDGKIEFLSDKGKGNIQVDVVAAESVE
KANWFVLTMRSIGGFFGDVWGSVSSTVKGWF
NT seq 1356 nt   +upstreamnt  +downstreamnt
ttgaagaaaacattttaccgtaagtctatcgctggattccttgccttggtcatgatatta
ggtcttttacctggtatacataaagctcatgcagaagatatcttaaacattaatgcagat
gctgctattttagtagatgcagagaccggaaaaattttatatcaaaaaaatgcggataaa
gtactgggcattgccagtatgactaaaatgatgacagaatacctgcttcttgaagccgtt
gaagaaggcaaagtgaagtgggaccaggaatatgcagtaagtgaatatgtgtggaaagtt
tcacaggatcgcaatttatcaaatgtcccattaagaagagacggaaaatacaatatccgt
gaattgtatgaagcaatggcgatctactctgcaaatggtgcaaccatcgcaattgcagaa
acgattgccggttctgagacaaactttgttaaaatgatgaacgaaaaagctgcagagctt
ggattaaaggattataaatttgtcaattccagcggtttaaacaaccgtgatttaaaggga
tctcctcctgcaggaggccctgaagaagaaaacgtgatgtcagcaaaagatacagcgatg
ctggccaaggaattgattaaccgattccctgaagtattggaaacagcaagtacccctaga
aagacgttcagagagggtacagatgatgaaattaaaatggaaaactggaactggatgctt
ccagagctagtatatggctatgaaggtgcagatggccttaaaacaggtacgactgacttt
gccggatactgctttaccggtacagccatgagagatggcaaccgctacatcagtgttgtc
atgaacgctaaaggtgcgaatggtcaggctacttacaaatccagattcgatgaaaccaaa
aaaatgttcgactttggtttcagcaacttcacgaaagaagaaatcgttcctgccaactat
caggtgaaaggccacaaaacagtgcctgttacaaaaggcaaagaggacaaagtaaagatt
tcttctaaagatgcaatcgaaatggttgtaagaaacggggaaaaagaaaactataagcct
gttcttgttattgataaagagaaattaaatgaaaacggcgaattgacagctcctattaaa
aaaggagaaaaaatcggctatctaacgattgaatcgaaagaggacgggaagattgagttc
ttgtccgataaaggcaaaggcaatattcaagtggatgtcgtagccgctgaaagtgttgaa
aaagcaaactggttcgtgctgactatgcgcagcatcggcggtttcttcggggatgtttgg
ggaagtgtttcctcaactgtaaaaggttggttttaa

DBGET integrated database retrieval system