KEGG   Bacillus oceanisediminis: A361_01435Help
Entry
A361_01435        CDS       T04330                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00473  D-Alanine metabolism
bon01100  Metabolic pathways
bon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A361_01435
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A361_01435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bon01011]
    A361_01435
Enzymes [BR:bon01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A361_01435
Peptidoglycan biosynthesis and degradation proteins [BR:bon01011]
 Precursor biosynthesis
  Racemase
   A361_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AND37880
UniProt: A0A160M676
LinkDB All DBs
Position
268321..269592
Genome map
AA seq 423 aa AA seqDB search
MGNHLSKPFDKNKHLTNPLPEFDNRHVEKQWLKDVNTSMNEQTKMYRDTWAEINLDHISY
NVESMKKHAEEGTNVIAVVKANGYGHGDAAVAEAALEAGASSLAVATLDEAMALRNKKIA
APILVMGASRPEHAGEAAAKNIALTVFQKEWLSQAYEYVEDGEVLNIHLKFDTGMGRLGI
RSRDELAGIESVIKKDKRFMLEGVFTHFATADSLENAYFEKQLSRFEEMTSWLEILPKYI
HTSNSAAGLRFPKAHFNAVRMGISMYGLAPSMEIKSYLPFPLKEAFSLHTSIVHVKKLHK
GEKVSYGATYEAQEDEWIATLPIGYADGWIRKLQGQEVLAEGLRVPIVGRVCMDQCMIKL
PHEMPVGTKVTLIGEQGEEKIPVDEIAEKLETINYEVTCMVSSRVPRIYKRDGKIIGGIN
YLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcatctttcaaagccttttgataaaaataagcatttgacaaaccctctgcca
gagtttgataatcgacatgtagagaagcaatggctaaaggacgtgaatacatcgatgaat
gaacaaacaaaaatgtaccgggacacttgggcagagataaatctggatcatatttcatat
aatgtagagtcaatgaaaaaacatgcagaagaagggacaaacgtcattgcggttgtgaag
gcaaatgggtatgggcatggagatgcagctgtggcggaagcggccctggaagcgggagca
tcctctctggctgttgccaccctggatgaggcgatggcattgagaaataaaaagattgca
gcgccgatcttagtaatgggagcgagccgcccggagcatgcaggtgaagcagctgcaaag
aatattgccctgaccgtttttcaaaaggagtggctatcacaagcatacgaatatgtggaa
gacggagaagtcctgaatatccatttaaagtttgatacaggcatggggcgcctgggtatt
cgaagccgtgatgagcttgcgggaattgagagcgttatcaaaaaggacaagcgttttatg
cttgaaggggtgtttacgcattttgccacagcggattcattggagaatgcttattttgaa
aagcagctgagcagatttgaggaaatgaccagctggctagagattttgccaaagtatatc
cataccagcaacagcgcggcgggccttagatttcccaaagcccacttcaatgctgtcaga
atggggatcagtatgtacggcctggctccttccatggaaattaagtcttatcttcctttc
cctctgaaagaagctttttctctccatacctctattgttcatgtgaaaaagcttcataaa
ggcgagaaggtcagctatggggcgacttatgaggcacaagaagatgaatggattgcaact
ttgccgatcggctatgcggatggctggatacgaaaacttcaggggcaggaggttcttgct
gagggattgagggttccaattgttggaagagtttgtatggatcaatgcatgattaagctt
ccgcatgaaatgcctgtcggtacaaaagtaaccctgatcggcgagcagggggaagaaaag
attccggttgacgaaatcgccgaaaaacttgaaaccatcaactatgaagtaacctgcatg
gtatcttcccgggttccgcgcatatataaaagagatggtaaaattatcgggggaattaat
tatctgctataa

DBGET integrated database retrieval system