KEGG   Bacillus oceanisediminis: A361_02425Help
Entry
A361_02425        CDS       T04330                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bon  Bacillus oceanisediminis
Brite
KEGG Orthology (KO) [BR:bon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A361_02425
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A361_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase Glutaredoxin FMO-like Lycopene_cycl TrkA_N
Motif
Other DBs
NCBI-ProteinID: AND38046
UniProt: A0A160M6H0
LinkDB All DBs
Position
complement(478269..479798)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQMMEGDILLKVSAGSDKVSSDMLALVDELANMSSRIKVERTELQR
TPSFSVNRPGEDTGITFAGIPLGHEFTSLVLALLQVSGRAPKVDQKVIDQVKKIEGEYRF
ETYVSLSCHNCPDVVQALNVMSVLNPNISHTMIDGAAYKEEVDAKEIMAVPTVLLNGESF
GSGRMSLEEILAKMGTGPDASEFADKDPYDVLVIGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVMDTLGIENFISVKHTEGPKLVASLEEHVKDYGIDVMNLQRAKRLEKKDLVEIELE
NGAVLKSKSVILSTGARWRNVNVPGEAEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGV
EAAIDLAGIVNHVTVIEFNPELKADAVLQERLNSLPNVTVVTNAQTTEITGTDKVNGISY
MDRETEKQHHVELQGVFVQIGLVPNTDWLGDQIERTRFGEIVVDKHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttacttgatgcagatataaaagcacaattagctcaatatcttcagatgatggagggc
gacatccttctaaaagtcagcgctggatcagataaagtatccagcgacatgctggcttta
gtagatgagctagccaatatgtcctcccgcattaaagttgagcgcactgaattacaaagg
acgccaagctttagtgtaaatcgtccaggtgaagatactggcattacctttgccggcatt
cctcttggacatgaatttacttccttagtgcttgctctgcttcaagttagcggtagggca
cctaaggttgaccagaaagtcatcgaccaggtgaagaagattgagggcgaatatcgtttt
gaaacttatgtcagcttaagctgccacaactgccctgatgtagtacaggctcttaacgtc
atgagtgttcttaaccctaatatttcacacacaatgatcgatggtgctgcttacaaagaa
gaagtagatgctaaagaaatcatggcagtgccgacagttcttctaaatggcgaatcattc
ggcagcggccgtatgtcccttgaagaaattctggcgaaaatgggaacaggccctgacgca
tcagagtttgcagataaggatccttatgatgtgcttgtcattggcggcggccctgcggga
tcaagcgcggcaatctatgctgcacgcaaaggcatccgcaccggcatcgttgctgaacgc
tttggcggccaggtaatggatactttaggcatcgaaaactttattagtgtgaagcataca
gaaggccctaaacttgttgcaagccttgaggaacatgtgaaagattatggcatcgatgtc
atgaatctgcagcgtgcaaagagacttgaaaagaaggaccttgttgaaattgaacttgaa
aatggtgctgtactgaaaagtaaatcagtcatcctttcaactggtgcacgctggagaaat
gtcaacgtgccaggtgaagcagagttcaaaaacaaaggggttgcttactgccctcactgt
gatggcccattatttgaaggcaaagacgtagctgttatcggcggaggcaactccggtgtt
gaagcagccattgaccttgcagggattgttaaccatgtaacggttatcgaattcaatcct
gaattgaaagcagatgccgttctgcaggaacgtctgaacagccttccaaacgtaacggtt
gtcacaaatgctcagacaactgaaattaccggaactgataaagtaaacggtatttcatac
atggatcgtgagacagaaaaacaacaccatgttgaactgcaaggtgtattcgtccaaatc
ggcctggttcctaacacagattggttaggcgaccagatcgagcgtactcgcttcggcgaa
atcgtcgtggacaagcacggtgccacaaacatccctggtgtatttgctgcaggagactgt
acagacagtgcctacaagcaaatcatcatctccatgggatctggtgcaacggcagctttg
ggtgcgtttgactatctgatccgtaattaa

DBGET integrated database retrieval system