KEGG   Bacillus oceanisediminis: A361_07295Help
Entry
A361_07295        CDS       T04330                                 

Definition
(GenBank) alpha-amlyase
Organism
bon  Bacillus oceanisediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase GHL10 Malt_amylase_C hDGE_amylase GHL6 Cyc-maltodext_C DUF4369
Motif
Other DBs
NCBI-ProteinID: AND38927
UniProt: A0A160M8K5
LinkDB All DBs
Position
1424550..1426088
Genome map
AA seq 512 aa AA seqDB search
MNKGIITFILIPFLLFYALPAGAAEKEERKWQDETFYFLMVDRFSNGDPNNDFKVDVQDP
KAYHGGDFKGITERLDYIKDMGFTAIWLTPVFDNEEKGYHGYWIKDFYNTEEHFGTMDEL
KQLVQEAHKRDMKVILDFVVNHVGTNHEWVNDPGKKDWFHEKQDIINWTNQSEIENGWIY
GLPDLKQENPEVQNYLIDAAKWWIEETDIDGYRLDTVKHVPKSFWTEFAKNVKSVKEDFY
LLGEVWSDDPKYIAEYEKTGIDGFVDYPLNDHLRTAFAEPDKSLSWLFANWDRNKAFYEN
PYLMGSFMDNHDTVRFTRDAITKNHHPGPRWKLALTYMYTTPGIPIVYYGSEIAMDGGED
PDNRRQMDFRTDKELIDYIAKLGEVRQMLPSLTRGDMELLEEKDGFAVYKRNYEDETTVI
VINNSTKSQKAVLDSTQLEEGKELRGMIADDLIRDKDGKYEMIIDREEAEVYVLAEKSGL
NIPLIAALAAVYSAFMIFIYLLWKRSKQKKSE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggaatcataaccttcatcttaatcccgtttcttcttttttatgccctgccg
gcaggagcagctgaaaaagaagagcgtaaatggcaagatgaaacattttatttcttaatg
gttgaccgatttagcaatggagatcccaacaatgactttaaagtcgatgttcaggaccca
aaagcttatcatggcggagattttaaggggattacagaacgcctggattatattaaagat
atggggtttaccgcaatttggctgactcccgtttttgataatgaagagaagggctatcac
ggttattggattaaagatttttataacacggaagagcactttggcacaatggatgaattg
aagcagttagtccaagaagctcacaaaagagatatgaaagtgattttggactttgttgta
aatcatgtgggcaccaatcacgaatgggttaatgaccccgggaaaaaggactggttccat
gaaaaacaagatatcatcaactggacgaatcaatctgagattgaaaatggctggatttat
ggactccctgatttaaagcaggaaaaccctgaggtacaaaactatttaattgatgcagca
aagtggtggatcgaagaaacggatattgatggatatcgtcttgatactgtaaagcatgtt
ccaaaatcattctggaccgaattcgccaaaaatgtaaagtcagtcaaagaagacttttat
ttgctgggggaagtatggtcggatgatccaaaatatattgctgaatatgaaaaaacagga
atagacggctttgttgattatcctttaaatgatcatttaagaactgcctttgcagagcct
gacaaatcgttaagctggctttttgcaaactgggaccgaaataaggcattttatgaaaat
ccctatctaatgggaagcttcatggataatcatgatactgtcaggttcactcgggatgct
atcacaaaaaatcatcatccgggtccaaggtggaaacttgccttaacatacatgtatacc
acacctgggattccaattgtttattatggaagtgaaatagctatggatggcggtgaggac
cctgacaaccgcaggcaaatggatttccgtacagataaagaactgattgattatatcgca
aaacttggggaagttaggcaaatgctgccatctttaacaaggggcgacatggaactgctg
gaggaaaaggacggttttgccgtttataaacggaattacgaagatgaaacaacggttatt
gtgatcaataattcaacaaagtcacagaaagcggtacttgattccactcaattagaagaa
ggaaaagagcttcgcggcatgattgctgatgatctcatccgagataaagacggaaaatat
gagatgatcattgaccgggaagaggctgaagtatatgttctggcagaaaaatcgggattg
aatattccgctgattgctgcacttgcagcagtttattcagcctttatgatttttatctat
cttttatggaagcggtcaaaacagaagaaatccgagtaa

DBGET integrated database retrieval system