KEGG   Bacillus oceanisediminis: A361_13060Help
Entry
A361_13060        CDS       T04330                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00020  Citrate cycle (TCA cycle)
bon00310  Lysine degradation
bon00380  Tryptophan metabolism
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01120  Microbial metabolism in diverse environments
bon01130  Biosynthesis of antibiotics
bon01200  Carbon metabolism
Module
bon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bon00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A361_13060
  Amino acid metabolism
   00310 Lysine degradation
    A361_13060
   00380 Tryptophan metabolism
    A361_13060
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A361_13060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N MRG
Motif
Other DBs
NCBI-ProteinID: AND40032
UniProt: A0A160MB53
LinkDB All DBs
Position
complement(2570111..2572954)
Genome map
AA seq 947 aa AA seqDB search
MKKPSNGEGPFEQGFHGPNLGYVIELYERYLEDPSSIDPEMKDYFERNGSPLASEGTPQM
ASSANQPMNAGQLEKTLAAIRLADNIRTYGHLAADIYPLGNNKSESALFELSKYGLTEND
LKEIPAGVITKDATYPLRNGLEAIEFLKSAYMGPIAFEFQHIFDENEKDWLRRKIGANSH
KLSMQKAEKLKVLRRLTEVEEFEKFLHKTFVGQKRFSIEGLDTMVPLLDEIVSESVSDGA
KTINIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAPNKELVPSEGSIGINYGWTGDVKYHL
GLDKQIKDENTTIARLTLANNPSHLEFVGSLVEGYTRASQDNRTKAGYPEVDPKAALAII
IHGDAAFPGQGIVAETLNLGQLTGYNTGGSIHIIANNTIGFTTESHDSRSTRYASDLAKG
YEMPILHVNADEPEAVVAAARIACEYRAKFQKDILIDLIGYRRFGHNEMDEPMTTNPIMY
NIIRKRPTVKALYADKLLNEKIISKEEAEGIHHEVLEKMKAAYEKVPKEKKEAELTNPPE
TVEKGLPKIKTAVSVDKLKQINEELLKWPEDFKVFDKLGKILQRRLEALEGDGKIDWGLA
ETLAFATILSDGTPVRLTGQDSERGTFAQRNVVLHDHTTGKAYSPLHKLSTAKASFAVHN
SPLSEAAVVGFEYGYNVFAPETLVLWEAQYGDFANAAQVMFDQFIAAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSARLERFLTLAAENNWTVANLSSSAQYFHILRRQAAILGKEEVRPL
VIMSPKSLLRNPNVASNGLELSEGEFKSVIEQPGLGQNHEKVKRIILGTGKITIDLSENL
KNYQDQDWFHILRVEEIYPFPMNQIKEILTRYPNVEEIVWIQEEPKNMGAWNFVEPRLKE
IAGSDIDVSYIGRRRRSSPAEGDPTVHKKEQARIIDETLTRKQEGGN
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccatcgaatggtgagggaccttttgaacaaggatttcatggccccaacctt
ggctacgttattgaactatatgaaagatacttagaggatccatcttctatcgatcctgaa
atgaaagactactttgaaagaaatggttcccctctagcgagtgaaggaactccgcaaatg
gcttcatcagcaaatcagccaatgaatgccggacagcttgaaaaaacacttgctgcgatt
cgccttgctgataatatccgcacatatggccacttggctgcagatatttatccgctgggt
aacaataaatctgaaagtgcattattcgaactgagcaaatatggcttaactgaaaatgat
ttaaaagagattcctgccggtgtcattactaaagacgccacctatccattacgcaacgga
cttgaagcaattgaattcctgaaaagcgcttatatgggaccaattgcgtttgaattccag
catatatttgatgaaaacgaaaaagactggcttcgccgtaaaataggggccaacagccat
aaactgtcaatgcagaaggcagaaaaactgaaagttttaagaagactgactgaagttgag
gaatttgaaaaattccttcataaaacattcgttggccagaaaagattctcaattgagggt
cttgatacaatggttccattactggatgaaattgtttctgaatccgtttctgatggagcc
aaaacaattaacatcggcatggcccaccgcggaagattaaatgttcttgcccatgtgctt
ggaaagccgtatgaaatgatcttcgcggaattccagcatgcgccaaataaagaactggtt
ccttccgaaggatctatcggaatcaattacggctggacaggcgacgttaaatatcacctt
ggtcttgataaacagatcaaagatgagaatacgaccatagccagactgacattagctaac
aatccgagccatcttgaatttgtaggttcactggttgagggctataccagagcttcacag
gataatagaacaaaggccggttatcctgaagtagatccaaaagctgctttagccattatc
attcatggagacgcagcattcccaggacagggaattgtagcagaaacactgaaccttgga
cagctgactggctacaatacgggcggttcgatccatatcattgccaataatacaattggt
ttcacaacagaatcacatgattcacgttctaccagatatgcaagtgatcttgccaaaggt
tatgaaatgccaattctgcatgtgaatgcagatgaacctgaagcagtagttgcagcggca
agaattgcttgtgaatatcgtgcgaaattccaaaaggatatccttatcgacttaatcgga
taccgcagatttgggcacaacgagatggacgagcctatgacgactaatcctattatgtat
aacattattcgcaagcgtccaaccgtgaaagcgctgtatgctgataagcttctaaatgaa
aagatcatttccaaagaggaagcagagggcattcatcatgaagtactggaaaaaatgaag
gctgcctatgaaaaggttccaaaagaaaagaaagaggcggagttaaccaatccacctgaa
acagtcgaaaagggtctgccaaaaattaaaacagctgtgtctgtcgataaattaaagcaa
attaacgaagaattattaaaatggccagaggatttcaaagtgtttgataaactcggcaaa
atcctgcagcgcagattggaagcgcttgaaggagacggcaagattgattggggacttgct
gaaacactggcttttgcaaccattttatctgatggtacccctgtcagactgactggccag
gattccgagagaggtacatttgcacaaagaaacgttgttctgcacgatcatacaactgga
aaagcgtattcacctttgcacaagctttcaacggctaaagcatcattcgctgtccataat
agcccattatctgaagctgctgtcgtaggctttgaatatggatataatgtattcgctccg
gaaacgcttgttctatgggaagctcagtatggtgattttgccaatgcggcacaggtaatg
tttgaccagtttattgctgctggccgtgcgaaatggggccaaaaatcaggtcttgtcatg
cttcttccacatggctatgaaggacagggacctgaacattcaagtgcccgcctggaaaga
ttcctgactcttgcagcagaaaacaactggacagttgctaatctatcttcttcagcacag
tacttccatatcttaagaagacaggctgccattctcggaaaagaggaagttcgcccgttg
gtgatcatgtctcctaagagtctgctgcgcaatccgaatgtcgcttcaaatggactcgaa
ttgagcgaaggagaattcaagtctgttattgaacagcctggcttaggccaaaatcacgaa
aaagtgaaacgcatcattcttggaacaggtaagatcacaattgatttatccgaaaacctg
aaaaactaccaggatcaggattggttccatattttacgagtggaagaaatctatccgttc
ccaatgaatcaaattaaagaaattttaacccgctatcctaatgtagaagaaatcgtttgg
attcaggaagaaccaaaaaatatgggtgcatggaatttcgttgaacctagactgaaagaa
atcgcaggcagcgatatcgatgtcagctacattggaagaagacgccgttcaagcccggct
gaaggtgacccgactgttcataagaaagaacaagcacgtataatagatgagaccctaaca
cggaagcaagaaggaggaaattaa

DBGET integrated database retrieval system