KEGG   Bacillus oceanisediminis: A361_15535Help
Entry
A361_15535        CDS       T04330                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00270  Cysteine and methionine metabolism
bon00450  Selenocompound metabolism
bon00920  Sulfur metabolism
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01130  Biosynthesis of antibiotics
bon01230  Biosynthesis of amino acids
Module
bon_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A361_15535
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A361_15535
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A361_15535
Enzymes [BR:bon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     A361_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Aminotran_5 Beta_elim_lyase SelA DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AND40501
UniProt: A0A161JBQ3
LinkDB All DBs
Position
complement(3078154..3079356)
Genome map
AA seq 400 aa AA seqDB search
MVKENVQAGTKAVWAGEKDYLVHGATQVPVVLSVAYGYDDMDEWYDVAIGKKKGHIYGRN
TNPTVQAFEDKVKILEGAEAATSFSTGMAAISNTLSTFLVPGDRIVSMKDTYGGTNKIFT
EFLPRQQIDVVLCETGNHEQIEAEVAKGCKILYLETPTNPTVKITDIERMAKAGHDAGAI
VIVDNTFATPMNQNPISLGVDLVIHSATKFLGGHADALGGVVCGPHELVEKIYHYREING
ATMDPMAAYLMIRGMKTLHLRVRQQCKNAMELAKYLQTKDMVESVYYPGIETHPNHHIAK
KQMKDFGGMLSFAVKGGVDTVRDLLPKLQFANRAANLGAVETTVGPARTTSHVECTPEER
AAVGIPEGLIRVSCGIEEIEDIIADFEQAFSHAESVLKVK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaaaatgttcaggcaggtacaaaagcagtatgggctggggaaaaggattat
ttggtgcatggagccacccaggtgccggtcgtactcagtgtggcatatggatatgatgat
atggatgagtggtatgatgtagcgattggaaagaaaaagggacatatttatggaagaaat
acgaatccaaccgtacaggcatttgaagataaagtgaaaattctggaaggcgccgaagca
gcgacaagcttttcaacaggtatggctgcaatcagcaatacgttatcaacgttcttggtg
ccgggtgatcgcattgtatcgatgaaggacacatatggcggaacgaacaagatttttacg
gaatttctgccccgccagcaaatcgatgtggttctttgcgaaacggggaatcacgagcaa
atagaggcagaagtggcaaaagggtgcaaaattctttacctcgaaacaccgacgaatcca
accgtcaagattactgatattgagcgcatggcaaaagccgggcacgatgccggagcgatc
gtcattgtggataatacttttgcaacgccaatgaatcagaaccccatttcactgggtgtg
gatctggttatccacagtgctacaaaattcctcggcgggcatgctgatgcactgggcgga
gtcgtttgcggtccgcatgaacttgtggaaaaaatctatcattatcgcgaaatcaatggt
gccacaatggatccgatggcagcttacctgatgatccgcggaatgaaaacacttcacctt
cgtgtccgccagcaatgtaaaaatgcaatggagcttgcaaagtacctgcagacaaaagat
atggtggaatctgtctattatccagggattgaaacacatccaaaccatcatattgccaaa
aaacaaatgaaggattttggtgggatgctcagctttgctgttaaaggcggagtagataca
gtccgtgatttgctaccgaaattgcaatttgccaaccgcgctgcaaacctcggagctgtt
gaaacaacagtagggccggcccgaacaacgagccatgtagaatgtacgcctgaggagcgt
gcagctgttggcattccggaagggttaatccgtgtctcctgcggaattgaagaaattgag
gacatcattgcagactttgaacaggcatttagccatgcagaaagtgttttgaaggtaaag
tag

DBGET integrated database retrieval system