KEGG   Bacillus oceanisediminis: A361_19745Help
Entry
A361_19745        CDS       T04330                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bon  Bacillus oceanisediminis
Brite
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A361_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4455
Motif
Other DBs
NCBI-ProteinID: AND41294
UniProt: A0A160MEK0
LinkDB All DBs
Position
complement(3924692..3925582)
Genome map
AA seq 296 aa AA seqDB search
MSKMEDYIKEVTKWNKELRDFLDSEDVEQNDELWQRLDHFTEIMDGINGPLDIEALEKLQ
EHVDTLHSDMENYFTNRQQLGNIYINEPYISAGKHFLPPLPYDYSALEPHISGEIMRLHH
DKHHQSYVDGLNKAEVMLQNARDNNDYSLVKHWSRELAFHGSGHYLHTIFWNNMSPEGGG
KPSGALLKEINKYFGSFERFKNHFTEAAKQVEGVGWAILVWSPRARRLEILQSERHMLLT
QWDTIPLLVLDVWEHAYYLQYKNNRGDYVKSWWNVVNWKDVEDRYLKASELKWKPF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatggaagattacatcaaggaagttacaaaatggaacaaagagctaagagat
ttcttagactcggaggatgttgaacaaaacgatgaactgtggcaaaggctggatcatttt
accgaaattatggatggaataaacggtcccctcgatattgaagccctggaaaagctgcag
gaacacgtagatactcttcattccgatatggagaattattttactaatagacagcagctt
ggaaatatctatatcaatgaaccgtacatttctgcgggtaagcactttttgcctccgctc
ccttatgattacagtgcacttgaaccgcatatctcaggtgaaattatgagactgcatcat
gataagcatcatcaatcttatgtggatggattgaataaagcagaagtgatgcttcaaaat
gcgagagacaataatgactacagtctcgtaaaacactggtcccgtgaactcgcctttcat
ggatcgggccattatttgcatacgatattctggaataatatgagccctgagggcggagga
aaaccttctggggcactcctcaaagaaattaacaaatactttgggagctttgagaggttc
aaaaaccatttcactgaagcagccaaacaggtagagggcgtaggctgggcaatactggtc
tggtcgccaagagcgcgcagactcgaaatacttcagtcggaaagacatatgctcttaacc
cagtgggatacgatcccattgctggttttagatgtatgggaacatgcatattatctgcaa
tataaaaataatcgtggagattatgtgaaaagttggtggaatgttgtcaactggaaggat
gtagaagacaggtatttaaaagcatctgagttaaaatggaagccgttctaa

DBGET integrated database retrieval system