KEGG   Bacillus oceanisediminis: A361_23770Help
Entry
A361_23770        CDS       T04330                                 

Definition
(GenBank) phosphatidylglycerophosphatase A
Organism
bon  Bacillus oceanisediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA Swi3 TBPIP
Motif
Other DBs
NCBI-ProteinID: AND42034
UniProt: A0A160MGC8
LinkDB All DBs
Position
4735189..4735692
Genome map
AA seq 167 aa AA seqDB search
MNEEKKAVNVTEQTARKWLHERGVEIQDIADLVFFLQEKYHPNLQMKDCIHNVERVLSKR
EVQNAILTGIQLDMLAEEKKLLEPLQSIIATDEGLYGADEVLALSIVNVYGSIGFTNFGY
IDKLKPGILKDLNDKSSGRCHTFLDDIVGAIAAAASSRLAHSAENAE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaaaaaaagcagttaacgttacagagcagacagcacgtaaatggctccat
gaaagaggggtagaaattcaggatatagctgatttagtgttcttcctccaagagaaatat
caccccaatttacaaatgaaagattgcattcataatgttgagcgtgttttatcaaaaaga
gaagttcaaaacgccattttaacgggcattcagcttgatatgctggccgaggaaaagaaa
ctcttagagccgctgcagtcgattatcgctacagatgagggtttatatggagcggatgaa
gtactggcattatccattgtaaacgtatatggttccattggatttaccaattttggatat
atcgataaattgaagcctggcatcctgaaggatctgaacgataagagttcaggaagatgc
cataccttcctcgatgatattgtcggagctatcgctgcagccgcttcgagcaggctggca
cacagtgccgaaaatgcggaataa

DBGET integrated database retrieval system