KEGG   Bacillus oceanisediminis: A361_24350Help
Entry
A361_24350        CDS       T04330                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00340  Histidine metabolism
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01230  Biosynthesis of amino acids
Module
bon_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A361_24350
Enzymes [BR:bon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     A361_24350
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     A361_24350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG RNA_pol_Rpb4
Motif
Other DBs
NCBI-ProteinID: AND42143
UniProt: A0A160MGI7
LinkDB All DBs
Position
complement(4849637..4850281)
Genome map
AA seq 214 aa AA seqDB search
MNIESVKFDEKGLIPAVVQDAKTKEVLTLAYMNRESLLKSAETGETWFFSRSRNELWHKG
ATSGNTQKIVEMKLDCDQDAIVVMVEPAGPACHNGTVSCFEERVYGEGSGGLSEYEILYT
LEKVIEEREKTRPEGAYTTYLFEKGVDKILKKVGEESAEVIIAAKNRDKDELKWEAADLI
YHLMVLLREQELPFNEVLKILNKRHDKKSEPASE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaaagtgtaaagttcgatgaaaagggactgatccctgcagttgtacaggat
gcaaaaacaaaagaagtattaacgttagcatatatgaatcgggaatcccttttaaaatcg
gcggaaacaggtgagacctggtttttcagccgttcccgcaatgagctttggcacaaaggg
gcaacaagcggcaacacacagaaaattgttgaaatgaagcttgactgtgatcaggatgcg
attgtggttatggttgaaccagcaggtcctgcctgccacaatggaacagtcagctgcttt
gaggaaagagtatacggggaagggtcaggcggcttatctgagtacgaaatcctttataca
cttgaaaaggtcattgaagaacgggaaaagacacgccctgaaggagcatacacgacatat
ctttttgaaaagggcgtggataaaatcctgaagaaggtcggcgaagaatccgcagaagtc
atcatcgctgcgaaaaaccgtgataaggacgaactgaaatgggaagcagccgacctgatt
tatcatttgatggtgctgctgcgggagcaggaactgccttttaatgaggtattaaaaata
ctgaataaacggcatgacaagaaaagcgaaccggcctccgaatag

DBGET integrated database retrieval system