KEGG   Boseongicola sp. CCM32: E2K80_02580Help
Entry
E2K80_02580       CDS       T05925                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
boo  Boseongicola sp. CCM32
Pathway
boo00970  Aminoacyl-tRNA biosynthesis
boo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E2K80_02580 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:boo03029]
    E2K80_02580 (gatB)
Enzymes [BR:boo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     E2K80_02580 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     E2K80_02580 (gatB)
Mitochondrial biogenesis [BR:boo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    E2K80_02580 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: QBX99746
UniProt: A0A4P7J9D5
LinkDB All DBs
Position
complement(521852..523363)
Genome map
AA seq 503 aa AA seqDB search
MLDLTYDLPKPKTISGARQDWELVIGMEVHAQVASDAKLFSGASTSFGAEPNSNVAFVDA
GMPGMLPVINEFCVEQAVRTGLGLNAEIHLRSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GDVLVEMGDGTARPVRIERIHLEQDAGKLIHDMDPAMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSVCAPGQYEKYQATQDFDHLGTRC
EIKNMNSLRFIQQAIEVEAKRQIAILEAGGKIDQETRLYDPDKGETRSMRSKEEAHDYRY
FPCPDLLPLEIEQAWVDEIEASLPELPDARKARFIDDFGLSDYDASVLTADTDSAAYFEA
VAAESDGKLAANWVTNELFGRLKKEDHDITASPVSPAQLAGIITLITAGDISGKIAKDLF
EIVYTEGGDPAEIVEARGMKQVTDTGAIEAAVDEIIATNPAQVEKAKQNPKLAGWFVGQV
MKATGGKANPKAVNQIVSDKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatttgacctatgatctgcccaaacccaaaaccatctccggtgccaggcaggat
tgggaacttgtgatcgggatggaggttcacgcccaggttgcctccgacgccaagctgttt
tccggcgcctccacctcattcggggccgaacccaattccaatgtggcctttgtcgatgcg
ggcatgcccggcatgttgccggtgatcaatgaattctgcgtcgaacaggcggtgcgcacc
ggccttggcctgaatgcagagatccacctgcgctcggccttcgaccgcaagaattatttc
tatcccgacctgccccagggctatcagatcagccagctttatcatccgatcgtgggcgaa
ggcgatgtgctggtcgagatgggcgatggcaccgcgcgtcctgtgcggatcgagcggatt
catctggaacaggatgcgggcaaactgatccatgacatggacccggccatgtcctttgtc
gatctgaaccgcaccggtgtggcactgatggagatcgtctcccgccctgacatccgcggc
ccggaagaggcggcggcctatgtcaccaaactgcggcagatcctgcgttatctgggcacc
tgtgacggcaatatgcaaaacggcaatctgcgcgccgatgtgaatgtctctgtctgcgcc
cccggccagtatgaaaaatatcaggcgacccaggatttcgatcatctgggcacacgctgc
gaaatcaagaacatgaactccctgcggttcatccagcaggccatcgaggtggaggccaaa
cgccagatcgcgatactggaggcaggcggcaagattgatcaggaaacccgtctctacgac
ccggacaagggcgaaacccggtccatgcgctccaaggaagaggcgcatgactatcgctat
ttcccctgccccgatctgctgccgctggagattgaacaggcctgggttgatgagatcgaa
gcctccctgccagagcttcccgatgccaggaaggcccgtttcatagatgatttcgggctc
agcgattatgacgcctcggtgctgaccgccgacacggattccgccgcctattttgaggca
gtggccgccgaaagcgacggcaagctggccgccaactgggtgaccaatgaattgttcggc
aggctgaaaaaggaagatcacgatatcaccgcatcgcccgtcagcccggcgcagctggcc
ggtatcatcaccctgatcaccgccggtgacatctcgggcaagatcgccaaggacctgttc
gagattgtctataccgaaggcggcgacccggcggaaatcgtcgaggcgcgcggcatgaaa
caggtcaccgataccggcgcgatcgaggccgcggtggacgagatcatcgccaccaatccg
gcacaggtcgagaaagccaaacagaacccgaaactcgcgggctggtttgtgggtcaggtg
atgaaagccaccggcggcaaggccaacccgaaagcggtgaaccagatcgtgagcgataag
ctgggcctgtga

DBGET integrated database retrieval system