KEGG   Boseongicola sp. CCM32: E2K80_13615Help
Entry
E2K80_13615       CDS       T05925                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
boo  Boseongicola sp. CCM32
Pathway
boo00030  Pentose phosphate pathway
boo01100  Metabolic pathways
boo01110  Biosynthesis of secondary metabolites
boo01120  Microbial metabolism in diverse environments
boo01130  Biosynthesis of antibiotics
boo01200  Carbon metabolism
boo01230  Biosynthesis of amino acids
Module
boo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
boo_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
boo_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:boo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    E2K80_13615
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    E2K80_13615
Enzymes [BR:boo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     E2K80_13615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: QBY01635
LinkDB All DBs
Position
complement(2800123..2801127)
Genome map
AA seq 334 aa AA seqDB search
MVEMVSRPYERAFEKHALANPDVLCISADLTSSCEIDKFRDNYPDQFLSMGMAEQNMMSF
CGGLGLAGYRPFVHTFGVFTYRRPYDQLMASIAYPRRKVRIMGFLPGITTPGGMTHQAIE
DISVMRSMPNMTILETGDATEVESICEAADSIDGPVYCRVLRGSMPRLFDTPIVVGQMRE
LSLGSDVLIVTAGITTEEALRATKALETSGVSVRHLHLNTIKPFNAGAILDHINSVKGGV
ITLENHVTEGGIGSLVAEIMADNGVGKKLKRLGLNDTYAHGGSRAYLMRYYGLDALALTQ
GVEGLLGQKLDITEQDLAEARVDAVHSLAKAEGL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaatggtaagccgcccgtatgagcgcgcctttgaaaaacacgcactcgccaat
ccggatgttttgtgcatctctgcggatctgacgtcgtcgtgcgaaatcgacaaatttcgc
gacaattaccccgaccagttcctttcaatgggaatggcagagcaaaacatgatgagcttt
tgcggcggtctgggcctcgcggggtatcgtccgttcgttcataccttcggcgtgttcacc
tatcgcagaccctatgaccaactgatggcatccatcgcgtatccgcggcgcaaagtgcgg
attatgggtttcttgccgggtatcaccacgccgggcggcatgacccaccaggcgatcgaa
gacatctcggtcatgcggtcgatgccaaacatgaccatccttgaaaccggtgacgcgacc
gaggtcgagagcatttgcgaagccgcagacagtatcgacggccccgtctattgtcgggtc
ttgcgaggatcgatgccacggcttttcgatacgcctatcgtcgttggacaaatgcgcgag
cttagtcttgggagtgatgtgttgatcgtgacagcagggatcaccacggaagaggcattg
cgcgcgacgaaggcgctggaaacgtccggtgtgtcggtccgacacctccacttgaatacc
atcaaaccgttcaacgccggggccatccttgatcatatcaattctgtcaaaggtggtgtg
atcactttggaaaaccatgtgaccgaaggcggtataggctcgcttgttgccgaaataatg
gcagataacggggttggcaaaaagctcaagcgtttgggtctgaacgacacctatgcccat
ggcggtagccgggcttatttgatgcgatactatggtttagatgcacttgccctgacgcag
ggcgtagaaggcttgcttggccaaaagctcgacatcaccgaacaggatttggccgaagcg
cgtgttgacgcggtccattcccttgccaaagccgaggggctgtaa

DBGET integrated database retrieval system