KEGG   Bosea sp. PAMC 26642: AXW83_05290Help
Entry
AXW83_05290       CDS       T04264                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00500  Starch and sucrose metabolism
bop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXW83_05290
Enzymes [BR:bop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AXW83_05290
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AXW83_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 DUF349 GHL6 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AMJ59791
UniProt: A0A126NW62
LinkDB All DBs
Position
1127383..1130667
Genome map
AA seq 1094 aa AA seqDB search
MNMIQPTITPDANAADPQWYKDAIIYQVHVKSFFDANDDGIGDFPGLIAKLDYIVSLGVN
VIWLLPFYPSPRLDDGYDISEYKAVHPDYGTAADVKRFIRAAHDRGIRVITELVINHTSD
QHPWFQRARAAKPGSPHRNFYVWSDNNQLYSGTRIIFLDTERSNWTWDATAGAYFWHRFY
SHQPDLNFDNPAVLKAVLGVMRFWLDLGVDGLRLDAVPYLIERDGTSNENLPETHAVLKQ
IRADLDASFPDRMLLAEANMWPEDTQAYFGEGDECHMAFHFPLMPRMYMAIAQEDRFPIT
DIMRQTPDIPEACQWAIFLRNHDELTLEMVTDKERDYLWNFYATDKRARINLGIRRRLAP
LLERDRRRIELMNSLLLSMPGTPVIYYGDELGMGDNIFLGDRDGVRTPMQWSPDRNGGFS
KADPASLVLPPVMDPLYGFDAVNVEAQTRDAHSLLNWTRRILGVRKEHKAFGRGALRFLY
PKNRKAFAYLREYDGETILCVANLSRSAQAFELDLSEFAGRHPIEMLGNSIFPAIGQLTY
LLTLPPYGFYWFILAQDAQAPSWHAQTPEPMPDYTTFVLRGGADEMITPQNRAEFEANIL
PPYLAKRRWFAAKDQKLDSARVVFTARIGLKRESALVAVEATHGKGTERYLLPLGIGWDD
EATTALPQQMALARVRRGRRTGFLTDAFALASFIHELLALLKTGSTIKSTFGQISFRPTA
AFENVEVLPEDPVRWLSAEQSNSSVIIDHKVMLKLFRRLAPGQHPEAEMSRVLTERGFRN
APALLGEIVHVPDDGEAEVMAVIQAFIPGEGDAWEWTSSYIGRVIDDMTREDVDLHDQLA
LYEGFSRTLGQRLGEMHRVLAQETEDEAFKPLPAGREQVERWLKRIRSRVDAACENLSSR
RDALPEEEQALADSVLERRDALLALVEQLSREGEGSLLHRIHGDFHLGQVLVASGDAMII
DFEGEPAQPLAERRAKDSGWRDVAGILRSLDYALAAGRRAGTAAGREARYALLDDAFRKT
MPKALLQGYHDALTTQPGERAPDGENGLLELFMLEKAAYEINYEVSNRPEWLVVPLRGMT
ELMDRLLARKTQDD
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatacagccgacgatcacgcccgacgccaatgcggccgatccgcaatggtac
aaggacgcgatcatctaccaggtgcatgtaaagtcgtttttcgacgccaacgacgatggc
atcggcgactttccgggtctgatcgccaagctggattacatcgtcagcctcggtgtcaac
gtgatctggctgttgccgttctatccttcgccgcggctcgacgatggctacgacatctcg
gaatacaaggcggtccatcccgactacggcacagcggctgatgtgaagcggttcatccgt
gcggcgcatgaccggggtatccgcgtgatcaccgagttggtgatcaaccacacctccgat
caacatccctggttccagcgggcgagggcggcaaagcccggctcgccgcatcgcaatttt
tacgtctggtcggacaacaaccagctctactccggcacgcgcatcatctttctcgatacc
gagcgctccaactggacctgggacgcaacggcgggagcctatttctggcatcggttttat
tcgcaccagccggatctgaacttcgacaatcccgcggtgctcaaggccgtgctcggcgtg
atgcgcttctggctcgatctgggcgtggatggcctgcgtctcgatgccgtgccatatctg
atcgagcgcgacggcacctccaatgagaatttgcccgagacccacgccgtattaaagcag
atccgggcggatctggatgcttcgttccccgaccgcatgttgctggcggaagcgaacatg
tggccggaggatacccaggcctatttcggtgaaggcgacgaatgccacatggcgttccac
ttcccgctgatgccccggatgtatatggcgatcgcgcaggaagaccgcttcccgatcacc
gacatcatgcggcagacgccggatattcccgaggcctgccaatgggcgattttcctgcgc
aaccatgacgagttgacgctcgaaatggtcaccgacaaggagcgggactacctctggaac
ttctacgccaccgacaagcgcgcccggatcaatctcggcatccgacgcaggctcgcgccg
cttctcgaacgggaccggcgccgtatcgaactcatgaacagcctgctgctttcgatgccg
ggaaccccggtcatctactacggcgacgaactcggcatgggcgacaatatcttcctgggc
gaccgggacggcgtccgtacccccatgcaatggtcgccggaccgaaacggcggcttctcg
aaggcggacccggccagcctcgtcctcccgcccgtcatggatccgctttatgggttcgat
gccgtcaatgtcgaggcgcagacgcgcgacgcccactcgctgttgaactggacacgacgc
atcctcggcgtgcgcaaggaacataaagccttcgggcgcggagcgttgcgcttcctctat
ccgaagaaccgcaaggctttcgcatatctgcgcgaatatgatggcgagacgatcctgtgc
gtcgccaacctctcgcgctcggcacaggcgttcgagctcgacctgtccgaatttgcgggt
cgccaccccatcgagatgctcggcaactcgatcttcccggcgatcggccagctcacctac
cttttgacgctcccgccttacggcttctactggttcatcctggctcaggatgcccaggcg
ccgtcatggcacgcgcaaactcccgagccgatgccggactacaccaccttcgtgctgcgc
ggcggagcagacgagatgatcacgccgcaaaatcgggccgagttcgaagcgaatatcctc
ccgccataccttgcgaaacgtcgctggtttgccgccaaggatcagaagctcgacagcgct
cgggtcgtattcacggcacggatcggcctgaagcgcgagtcggccctcgtcgctgtcgag
gccacgcacggcaagggaaccgagcgctatctcctgccgctggggatcggctgggacgac
gaggccacgacggctctgccgcagcaaatggcgctggcgcgggtccgacgcggacgccgc
acgggcttcctgaccgacgcctttgcgctggcaagcttcatccatgaactgcttgccctg
ctgaagacgggaagcacgatcaagagcacgttcggacagatctcgttccggccgaccgca
gccttcgagaacgtcgaggtcctgcccgaagatcccgtgcgctggctctcggccgagcag
tcgaattcgtcggtcatcatcgaccacaaggtgatgctgaaactgttcaggcgccttgct
cccggtcagcatcccgaggcggaaatgtcgcgggtgttgacggagcgcggcttccgtaac
gccccggcgctgctgggcgaaatcgtccacgtccccgatgacggcgaggccgaggtcatg
gcggtgatccaggccttcatcccgggcgagggcgacgcctgggagtggacctcgtcctat
atcggccgcgtcatcgacgacatgacgcgcgaggacgtcgatctccatgaccagcttgcg
ctctacgagggcttttcgcggacgctgggacagcgcctgggagagatgcatcgtgtgctc
gcacaagagacggaggatgaggccttcaaaccgctgcctgccgggcgcgagcaggtcgaa
cgctggttgaagcgtatccgcagccgggtcgacgctgcctgcgagaatttgagcagccgc
cgcgacgcgcttcccgaggaggagcaggcgcttgccgacagcgtcctggagcgccgcgat
gcccttctcgctctcgtcgagcagctgagccgcgaaggtgaggggagcctgcttcaccgg
atccatggcgacttccatctcggccaggtgctggtggcgagcggcgatgcgatgatcatc
gacttcgagggcgagcctgcgcagcctctggcggagcggcgggccaaggacagcggctgg
cgcgatgtcgccggtatcctgcgctccctggattacgcgctcgctgcggggcggcgcgcg
ggcactgctgcagggcgggaagctcgctacgctttgttggacgatgccttccgcaagacg
atgccgaaggcactgctgcagggttatcacgatgccttgaccacgcagccgggcgagcgc
gcgccggacggagaaaacggcctgctcgaactcttcatgctcgaaaaggcggcctacgag
atcaactacgaagtcagcaatcgtccggaatggttggtcgtgcctttgcgcggcatgacc
gagcttatggatcggctcctggcgagaaagacgcaggatgactga

DBGET integrated database retrieval system