KEGG   Bosea sp. PAMC 26642: AXW83_07555Help
Entry
AXW83_07555       CDS       T04264                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00010  Glycolysis / Gluconeogenesis
bop00020  Citrate cycle (TCA cycle)
bop00620  Pyruvate metabolism
bop01100  Metabolic pathways
bop01110  Biosynthesis of secondary metabolites
bop01120  Microbial metabolism in diverse environments
bop01130  Biosynthesis of antibiotics
bop01200  Carbon metabolism
Module
bop_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXW83_07555
   00020 Citrate cycle (TCA cycle)
    AXW83_07555
   00620 Pyruvate metabolism
    AXW83_07555
Enzymes [BR:bop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXW83_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AMJ60173
UniProt: A0A126NU88
LinkDB All DBs
Position
complement(1612389..1613717)
Genome map
AA seq 442 aa AA seqDB search
MPTNILMPALSPTMEKGNLAKWLKKEGDAIKSGDIIAEIETDKATMEVEAVDEGILAKIL
VPDGTADVAVNEIIGVIAAEGEDAKSVSAPVKAEAPKAEASKAEPAATKPAEAAPPAAAT
APASSGDRPFASPLARRLAKEARLDLGKVQGSGPHGRIVEKDIEAAKAGGGAKASAPAPQ
TSAPSAAKPAAAPLAAGMSDETVKKLFAPGSYEEIPHDGMRKTIARRLLESKQTIPHFYL
TIDCELDALLKLRGELNAAAPEIDDKPAYKLSVNDMVIKAMAMSLRAVPDANVSWTENTM
LKHKHADVGVAVSIPGGLITPVIRDACHKTLSQISNEMKDLAARAKNRKLKPEEYQGGTT
AVSNLGMFGVKDFAAIVNPPHATILAVGAGEQRAIVRKGELAVATIMSVTLSTDHRAVDG
ALGAQLMQAFKGYIEKPMAMLV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaacatcctgatgcccgcgctctctcccaccatggagaagggcaatctcgcc
aaatggctgaagaaggaaggcgacgccatcaagtccggcgatatcatcgccgagatcgag
accgacaaggcgaccatggaagtggaagccgtcgatgagggcattctggcgaagatcctg
gtgccggacggcacggccgatgtagcggtcaacgagatcatcggcgtgatcgcggccgag
ggcgaggacgccaagagcgtgtcggctcctgtgaaggccgaagcaccgaaggccgaggct
tccaaggccgagcctgccgccacgaaaccggccgaggccgcgcctccggctgccgcaact
gctccggcatcgagcggtgatcgccctttcgcctcgccgctggcccgtcgcctcgccaag
gaggccaggctcgacctcggcaaggttcagggctcgggcccgcatggccgcatcgtcgaa
aaggacatcgaggcggccaaggccgggggcggtgccaaggctagcgcccctgccccccag
acgagtgcgccatcggcagccaagcccgccgctgctccgctcgccgccggcatgtccgac
gagaccgtcaagaagctgttcgcgcccggttcgtacgaggaaattcctcatgacgggatg
cgcaagacgatcgcgcgccgcctgctcgaatccaagcagaccatcccgcatttctacctg
acgatcgactgtgaactcgacgcgctactgaagctgcggggcgagctcaatgcggcggcg
cccgagatcgacgacaagccggcctacaagctgtcggtcaacgacatggtgatcaaggcg
atggcgatgtcgctgcgtgccgtgccggacgcgaatgtgagctggaccgaaaacaccatg
ctcaagcacaagcacgccgatgtcggcgtcgcggtctcgattcctggcggcctgatcacg
cctgtgatcagggacgcctgccacaagacgctgagccagatctcgaacgagatgaaggac
ctcgcggcgcgcgccaagaaccgcaagctgaagcccgaggagtatcagggcggcaccacg
gcggtcagcaatctcggcatgttcggcgtcaaggattttgccgccatcgtgaacccgccg
catgccacgatcctggcggtcggtgccggcgagcagcgcgcgatcgtccggaagggcgaa
ctggcggtcgcaacgatcatgtccgtgacgctatcgaccgaccatcgcgcggtggacggc
gcgctcggtgcgcagctgatgcaggcgttcaagggttatatcgagaagccgatggcgatg
ctggtgtga

DBGET integrated database retrieval system