KEGG   Bosea sp. PAMC 26642: AXW83_08835Help
Entry
AXW83_08835       CDS       T04264                                 

Gene name
oppD
Definition
(GenBank) oligopeptide transporter ATP-binding component
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXW83_08835 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bop02000]
    AXW83_08835 (oppD)
Transporters [BR:bop02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    AXW83_08835 (oppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_7 AAA_21 DUF3265 Herpes_ori_bp AAA_16
Motif
Other DBs
NCBI-ProteinID: AMJ60383
UniProt: A0A126NUW4
LinkDB All DBs
Position
1874464..1875480
Genome map
AA seq 338 aa AA seqDB search
MSALAQQAGPSPLVAIRDLAVSFDGVKVLHGIDLTVNRGEAVGLVGESGCGKSVTWLAAL
SLLPKKAKITGSVTLEGRELIGATPATLDSVRGGRIAMIFQDPASALNPVVKLGKQVGEA
LALHGGLSGSAIRAETKRLFDLVGIPDAVRRLDAFPHELSGGQNQRVMIAMALAGKPDIL
IADEPTTALDATIQAQILELLTRIRRETDMALVLISHDLGVISETCDRVCVMYAGRIIET
AASEPLFAQPLHPYTQGLLAALPPLEGVRRRLQPVEGNVPEPWNLPPGCSFAPRCPRRID
ACDMRLPPLDLKAPDRRAACIMTPPLGQPQRQPEPVFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcttgcgcagcaggcgggcccgagcccgctcgtcgcaatccgcgacctcgcg
gtctccttcgacggcgtcaaggtactccacggcatcgacctcaccgtgaaccgcggcgag
gctgtcgggctcgtcggcgagtccggttgcggcaaatcggtgacctggcttgccgcgctg
agcctgctgccaaaaaaggcgaaaattaccggcagcgtcacgctggagggccgtgaactg
atcggcgcgacgcccgcgacgctcgacagcgtgcgcggcgggcgcatcgctatgatcttc
caggatccggccagcgcgctgaacccggtggtcaagctcggcaagcaggtcggcgaggcg
ctggcgctgcatggcgggctttcgggcagcgccatcagggccgaaacgaagcggctcttc
gacctcgtcggcattcccgatgccgtccgccggctcgatgcctttccccatgagttgtcg
ggtgggcagaaccagcgcgtgatgatcgcgatggcgctcgccggcaagcccgacatcctg
atcgcggacgaaccgaccaccgcgctcgacgcgacgatccaggcacagattctcgaactg
ctgaccaggatcaggcgcgagaccgatatggcgctggtgctgatcagccatgatctcggc
gtcatctccgagacctgcgaccgcgtctgcgtgatgtatgccgggcgcatcatcgagacc
gcagcctcggagccgctgttcgcgcagccgctgcatccctatacgcaaggcctgctggca
gcactgccgccgctggagggcgtgcgccgccggctccagccggtcgagggcaatgtcccc
gaaccctggaacctgccgcccggctgttccttcgcgccgcgctgcccgcgccggatcgat
gcctgcgacatgcgcctgccgccgctcgacctcaaggcgcccgatcgccgtgccgcctgc
atcatgacgccgcccctcggccagccccagcgtcagccggagccggtcttcgcatga

DBGET integrated database retrieval system