KEGG   Bosea sp. PAMC 26642: AXW83_10360Help
Entry
AXW83_10360       CDS       T04264                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00473  D-Alanine metabolism
bop00550  Peptidoglycan biosynthesis
bop01100  Metabolic pathways
bop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXW83_10360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXW83_10360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AXW83_10360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bop01011]
    AXW83_10360
Enzymes [BR:bop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXW83_10360
Peptidoglycan biosynthesis and degradation proteins [BR:bop01011]
 Precursor biosynthesis
  Amino acid ligase
   AXW83_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AMJ60637
UniProt: A0A126NUM7
LinkDB All DBs
Position
complement(2189930..2190844)
Genome map
AA seq 304 aa AA seqDB search
MTKHVAVLMGGWSVEREVSLNTGAGCADALESVGYRVTRVDVQRDIAQVLGALRPDVVFN
ALHGRFGEDGTIQGLLEILGIPYTHSGVLASALAIRKDRAKTVVAAAGVPVAPGINVSRF
EAAKKHVLPPPYVLKPIDEGSSVGVVIVKKGREHPPQEIAREDWPCGETMMAEPFISGRE
LTCAVMGGKSLGVTEIQAATGEFYDYDAKYAKGGSIHICPAQILPKIYQQIEECSLTAHQ
AIGCRGVSRSDFRYDDESDTLVWLEVNTQPGMTETSLVPELAAHAGLNFGELVRWIVEDA
SLDR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacacgtcgcagtgctgatgggcggctggtccgtcgagcgtgaggtcagcttg
aacacaggcgccggctgcgccgacgcgcttgaaagcgtcggctaccgcgtcacgcgggtc
gatgtgcagcgcgacatcgcgcaggtgcttggtgccctgcgccccgatgtcgtgttcaat
gccctgcatggccgcttcggcgaggacggcacgattcagggcctgctcgagatcctgggc
attccctacacccattcgggcgtgctggcctcggcgctcgccatccgcaaggaccgggcg
aagaccgtggttgcggccgccggcgtgccggtggcacccggaatcaacgtatcgcgcttc
gaagcggccaaaaaacacgtgctgccaccgccttatgtgctcaagccgatcgacgagggg
tcctccgtcggcgtcgtgatcgtgaagaaggggcgcgagcatccgccccaggaaatcgcg
cgcgaagactggccctgcggcgagacgatgatggccgaacccttcatctccgggcgcgag
ctgacgtgcgccgtgatgggcggcaaatcgctcggtgtgaccgaaatacaagccgctacg
ggcgagttctacgactacgacgcgaagtacgcgaaaggtggctcgatccacatctgcccg
gcacaaattttaccaaaaatttaccagcagatcgaagagtgttcgttaacggcgcatcaa
gcaatcgggtgccggggcgttagcaggtcggacttccgatacgacgacgagagcgacact
ctcgtctggctggaggtcaacacgcagcccggcatgaccgagactagcctggtgcccgaa
ttggctgcccatgcgggcctgaacttcggtgaactcgtcagatggatcgtggaggacgcc
tccctggaccgatga

DBGET integrated database retrieval system