KEGG   Bosea sp. PAMC 26642: AXW83_13560Help
Entry
AXW83_13560       CDS       T04264                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00061  Fatty acid biosynthesis
bop00780  Biotin metabolism
bop01100  Metabolic pathways
bop01130  Biosynthesis of antibiotics
bop01212  Fatty acid metabolism
Module
bop_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXW83_13560
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AXW83_13560
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AXW83_13560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bop01004]
    AXW83_13560
Enzymes [BR:bop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AXW83_13560
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AXW83_13560
Lipid biosynthesis proteins [BR:bop01004]
 Fatty acid synthase
  Component type
   AXW83_13560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMJ61187
UniProt: A0A126NW63
LinkDB All DBs
Position
complement(2804713..2805555)
Genome map
AA seq 280 aa AA seqDB search
MPDAHTATVPTANLLKGKRGLVMGVANNRSIAWGIAKAAADAGAELAFTYQGDALKKRVE
PLAQQLGGHVVGHCDVTDPASIDAVFAEIERLWGKLDFVVHCIAFSDKDELTGRYVETSE
ANFTKSLLISCYSFTAVTQRAEKLMGDGGAMLTLTYYGAEKWMPHYNVMGVAKAALEASV
QYLAADLGPSKIRVNAISAGPIKTLAASGIGDFRYILRWNEYNSPLRRTVTIEEVGETAV
FLVSDMSRGITGEILHVDAGYHVVGMKVPTAPDITLDKGE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgcccatactgccacagttccgaccgccaacctcctcaagggcaagcgcggc
ctggtcatgggcgtcgcgaacaaccgttcgatcgcctggggcatcgccaaagccgcggcc
gatgcgggcgcggaactcgcctttacctatcagggcgatgcgctgaagaagcgcgtcgag
ccgctggcccagcagctcggcggccatgtcgtgggtcattgcgacgtcaccgacccggcc
tcgatcgatgcggtgttcgcggagatcgaaaggctctggggcaagctcgacttcgtcgtc
cactgcatcgccttctccgacaaggacgagctgaccgggcgctatgtcgagaccagcgag
gcaaacttcaccaagtcgctgctgatctcctgctattccttcaccgccgtgacccagcgc
gccgagaagctgatgggtgacggcggcgcgatgctgacgctgacctattacggtgccgag
aagtggatgccgcattacaacgtcatgggcgttgccaaggcggcgctggaggcgagcgtt
caatatctcgcggccgatctcggtccctcgaagatccgcgtcaacgcgatctcagccggc
ccgatcaagacgctggcggcctcgggcatcggcgatttccgctacattctgcgctggaac
gaatacaactcgccgctgcgtcgtacggtgacgatcgaggaggtcggcgaaaccgccgtg
ttcctggtttccgacatgtcgcgcggcatcaccggcgagatcctgcatgtcgatgccggc
tatcatgtggtgggcatgaaggtgccgaccgcgccggatattacgctcgacaagggcgag
tga

DBGET integrated database retrieval system