KEGG   Bosea sp. PAMC 26642: AXW83_13695Help
Entry
AXW83_13695       CDS       T04264                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bop  Bosea sp. PAMC 26642
Brite
KEGG Orthology (KO) [BR:bop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXW83_13695
Enzymes [BR:bop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     AXW83_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AMJ61211
UniProt: A0A126P041
LinkDB All DBs
Position
2831611..2832648
Genome map
AA seq 345 aa AA seqDB search
MRAVVIHAEKDLRVEATTAPDLGPLDVRVRIEAGGICGSDLHYYLHGGFGTIRVREPLIL
GHEIAGTVEAVGGEVSRVRPGDRVAVNPSRACGHCRYCQMGQQQHCTDMLFYGSAMRFPH
VQGGFRDILVVEERQAVKVAPGVTAAMAAFAEPLSVCLHAAKRAGPLLGKRVLVTGSGPI
GILAVVAAKAAGASEIVATDVVDGPLPTALDMGATAAINTMAEPDRLKAEYGAEKGAFDV
MFEASGNQHALTGAFDVVRSGGIIVQIGVGGNFTLPMNVLVAKEFDLRGSFRFHEEFDWA
VAMIGSGDIDLSPLLTASIPVDRAVEAFDLAADKSKAMKVQLAFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtcgtcatccatgccgagaaggatctgcgcgtcgaggcgacgaccgccccg
gatctgggtccgctcgatgtccgcgtcaggatcgaggccggcggcatctgcggctcggac
ctgcactactacctgcatggcggtttcggcacgatccgcgtcagggagccgctgatcctc
ggccatgagatcgccgggacggtcgaggcggtcggcggcgaggtttcgcgcgtcaggccg
ggcgaccgcgtcgccgtcaatcccagccgcgcctgcggccattgccgctattgccagatg
ggccagcagcagcattgcaccgacatgctgttctacggctcggcgatgcgctttccccat
gtccagggcggcttccgcgacatcctcgtcgtcgaggagcgtcaggcggtgaaggtagcg
ccaggtgtcacggcggcgatggcagccttcgccgagccgctctcggtctgcctgcacgcc
gccaagcgcgccggtccgttgctcggcaagcgcgtgctggtgacaggctcgggcccgatc
ggcatactggccgtggtcgcggccaaggcggctggcgcctcggagatcgtcgcgaccgac
gtcgtcgacggcccgctgccgacggctctcgatatgggcgcgaccgccgcgatcaacacc
atggccgagcccgaccgcctgaaggcggagtacggcgcggaaaaaggcgccttcgacgta
atgttcgaagcctcgggcaaccagcatgcgctgacaggagccttcgatgtcgtgcgctcg
ggcggaatcatcgtccagatcggcgtcggcggcaatttcacgctgccgatgaacgtgctc
gtcgccaaggaattcgacctgcgcggctcgtttcgcttccacgaggaattcgactgggcg
gtggcgatgatcggctcgggcgatatcgacctgtccccgctgctgaccgcatcgattccc
gtcgatcgcgctgtcgaggccttcgatctcgccgccgacaagtcgaaggcgatgaaggtg
cagctggccttcggctga

DBGET integrated database retrieval system