KEGG   Bosea sp. PAMC 26642: AXW83_14960Help
Entry
AXW83_14960       CDS       T04264                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00564  Glycerophospholipid metabolism
bop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AXW83_14960
Enzymes [BR:bop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AXW83_14960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 Lycopene_cycl FAD_oxidored GIDA Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AMJ61423
UniProt: A0A126NXU9
LinkDB All DBs
Position
3095445..3097004
Genome map
AA seq 519 aa AA seqDB search
MTGPVYDIAIIGGGVNGCSIARDAAGRGASIVLFEQGDLASATSSASTKLIHGGLRYLEH
YEFRLVREALAEREVMWRAAPHIVWPLRFVLPHHDGLRPWWILRLGLFLYDHLGGRRLLP
AARSLDLSRDAAGEALKPRFTRAFEYSDCWVEDSRLVVLNARDAAEHGATILPRTKVISA
RREAGHWLVTSQGPDGAEVTIRARALVNAAGPWVADVLNGIVPSNRPASVRLVQGSHIVV
RRLFEHERCYIFQNADGRIVFAIPYENDLTLIGTTDKDYEGDPAEVAAGEDEIAYLCAAA
SDYFRHPITREDVVWTYSGVRPLYDDGASKAQEATRDYVLTLDEPDGGAPMLSVFGGKIT
TSRRLAEAAVAKLAGARSAAALPTLRAAPWTAAATLPGGDFPPDGFKALVAETCARRPWL
DRDLARRLVRAYGTRAERILDGATGMADLGRVFGADLTEREVVYLMAQEWAASAHDVLFR
RSKLGLRLSPAEREALDAFMRHPPAGQDASRALQAESRS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtccggtctacgacatcgccatcatcggcggcggggtgaatggctgcagcatc
gcgcgcgatgcggccgggcgcggcgcttccatcgtgctgttcgagcagggcgatctcgcc
agcgcgacctcctcggcctcgaccaagctgatccatggcggcctgcgctatctcgagcat
tacgagtttcggctggtgcgcgaggcgctggccgagcgcgaggtgatgtggcgggcagcg
ccccatatcgtctggccgctgcgtttcgtgctgccgcatcatgatggcctgcggccctgg
tggatcctgcggctcggcctcttcctctatgaccatctcggcggccgccgcctgctgccg
gccgctcgctcgctcgatctcagccgcgatgccgcgggcgaagcgctgaagccgcgcttc
accagggcctttgaatattccgattgctgggtcgaggattcgcgcctcgtcgtactcaat
gcgcgcgatgcggccgagcatggcgcgaccatactgccgcgcaccaaggtaatctcggcc
cgccgcgaggccgggcattggctggtcacctcccaaggccccgacggtgccgaggtcacg
atccgcgcccgcgcgctcgtcaatgccgccggcccctgggtcgccgatgtgctgaacggc
atcgtgccgagcaaccggccggcctcggtccggctggtccagggcagccatatcgtcgtg
cgccggctgttcgagcatgagcgctgctacatcttccagaacgccgatgggcgcatcgtc
ttcgccatcccctacgagaacgacctcaccctgatcggcacgaccgacaaggactacgag
ggcgatccggctgaggtcgcggccggtgaggacgagatcgcctatctctgcgccgcggcg
agcgattatttccgccacccgatcacgcgcgaggatgtggtctggacctattccggcgtg
cgcccgctctatgacgacggcgccagcaaggcgcaggaagccacgcgcgactatgtgctg
acgctggacgagccggacggcggagccccgatgctctcggttttcggcggcaagatcacg
acctcgcgccgccttgccgaagccgccgtggccaagctcgccggcgccagatccgccgct
gccctgccgactttgcgcgcggcgccctggaccgcggccgcgacacttccgggcggcgat
ttcccccccgacgggttcaaggcgctggtcgccgagacctgcgcccggcgcccctggctc
gatcgcgatctggcgcgccggctggtgcgcgcctatggtacgcgcgcggaacgcattctc
gacggcgcgaccggcatggccgatctcggccgcgttttcggagccgatctgaccgagcgc
gaggtcgtctatctgatggcgcaggaatgggcggcgagcgcccatgatgtgctgttcagg
cgtagcaagctcggcttgcggctgtcgccggccgagcgggaggcgctcgacgcctttatg
cgccatcccccggcgggccaagacgcgtcgcgggccttgcaggcggagagccggtcatga

DBGET integrated database retrieval system