KEGG   Bosea sp. PAMC 26642: AXW83_16100Help
Entry
AXW83_16100       CDS       T04264                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00020  Citrate cycle (TCA cycle)
bop00310  Lysine degradation
bop00380  Tryptophan metabolism
bop01100  Metabolic pathways
bop01110  Biosynthesis of secondary metabolites
bop01120  Microbial metabolism in diverse environments
bop01130  Biosynthesis of antibiotics
bop01200  Carbon metabolism
Module
bop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXW83_16100 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AXW83_16100 (sucA)
   00380 Tryptophan metabolism
    AXW83_16100 (sucA)
Enzymes [BR:bop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AXW83_16100 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMJ61629
UniProt: A0A126NXT7
LinkDB All DBs
Position
3337304..3340261
Genome map
AA seq 985 aa AA seqDB search
MARQDINEALAQTGFLYGGNAAYIEDLYARYEADPKSVDEQWQGFFAGLKDEGSAIVQNA
RGASWTKPNWPIHANGELVSALDGNWSVVEKVISDKLGAKAKATGAAISASDVQQATRDS
VRAIMLIRAYRMRGHLHAKLDPLSIETVDNSDELSPAAFGFGEADLDRKIFIDNVLGLES
ATIREMTAILQRTYCNTIGIEFMHISDPEQKAWLQERIEGPDKEIAFTREGKKAILNKLV
EAEGFEKFIDLKYTGTKRFGLDGGESLIPALEQIIKRGGALGVRDIVFGMAHRGRLNVLT
QVLGKPHRALFHEFKGGSFAPDDVEGSGDVKYHLGASSDREFDGNNVHVSLTANPSHLEI
VDPVVLGKVRAKQDQFGDIVERSKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRTGGSI
HFIINNQIGFTTYPRYSRSSPYPSDVAKMVEAPVFHVNGDDPEAVVFAAKIAIEFRQKFH
KPVVVDMFCYRRFGHNEGDEPGFTQPLMYRKIRAHKSTLELYSAKLEAEGVIQAGELDEM
RAAWKARLEIEFEAGQAFKPNKADWLDGRWAGMKAIRADEDDPRRGATGVPAAVLKEITE
KITSVPPGFNVHKTIQRFLDNRRKAIETGKGIDWATAESLAFGSLLLDGNPVRLSGQDSE
RGTFSQRHSVLIDQETEARHTSLNHIREGQSRYEVINSMLSEEAVLGFEYGYTLSEPNAL
TCWEAQFGDFANGAQVLFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERFLQ
MCAEDNMQVANCSTPASYFHILRRQLKRDFRKPLILMTPKSLLRHKRCVSDLADIAEGST
FHRVLHDDAERGSSSTKLVKDSKIRRVVLCSGKVYFDLLEDREKRGIDDVYLMRVEQLYP
FPLKSLAQELARFKGADVVWCQEEPKNMGSWTFVEPYLEWVLGHAGVKSKRARYVGRPAS
AATATGLMSKHLAQLNAFLDEAFAA
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggctcgccaggacatcaacgaggctctcgcgcagacgggtttcctctatggcggcaat
gcggcctatatcgaggatctctacgcccgctacgaggccgatccgaaatcggtcgacgag
cagtggcagggcttcttcgccgggctgaaggacgaaggctcggccatcgtccagaatgcc
aggggcgcgtcctggaccaagccgaactggcccattcatgccaatggcgaactcgtctcg
gcgctcgacggcaactggagcgtcgtcgagaaggtgatcagcgacaagctcggcgccaag
gccaaggcgacgggcgccgcgatcagcgcgtcggacgtgcagcaggcgacgcgcgattcg
gtgcgcgcgatcatgctgatccgggcctaccggatgcgcggccaccttcacgccaagctc
gacccgctcagcatcgagaccgtcgacaattccgatgagttgtcgccggccgccttcggc
ttcggcgaagccgatctcgaccgcaagatcttcatcgacaacgtgctgggcctggaatcc
gcgacgatccgcgagatgaccgcgatcctgcagcggacctattgcaacaccatcggcatc
gagttcatgcacatctccgatccggagcagaaggcatggctgcaggagcggatcgagggg
cccgacaaggaaatcgccttcacccgcgagggcaagaaggcgatcctgaacaagctcgtc
gaggccgagggcttcgagaagttcatcgacctgaaatacaccggcaccaagcgcttcggc
ctcgatggcggcgagtcgctgattccggcgctggagcagatcatcaagcgcggcggcgcg
ctcggcgtgcgcgacatcgtcttcggcatggcccatcgcggccggctcaacgtgctgacc
caggtgctgggcaagccgcatcgcgcgctgttccacgagttcaagggcggctccttcgcc
cccgacgacgtcgagggctcgggcgacgtgaagtaccatctcggtgcctcgtcggaccgc
gaattcgacggcaacaacgtccacgtctcgctgacggccaacccgtcgcatctggagatc
gtcgatcccgtcgtgctgggcaaggtccgcgccaagcaggaccagttcggcgacatcgtc
gagcgctcaaaggtgctgccgctgctgctgcatggcgacgcggccttcgccggccagggc
gtcgtcgcggaatgcctcggcctgtcggggttgaagggtcaccgcaccggcggctcgatc
cacttcatcatcaacaaccagatcggtttcacgacctatccgcgttattcgcgctcctcg
ccctatccgtcggacgtggcgaagatggtcgaggccccggtcttccatgtcaacggcgac
gatcccgaggctgtcgtcttcgccgccaagatcgcgatcgagttccggcagaaattccac
aagccggtcgtcgtcgacatgttctgctatcgccgcttcggccataatgagggcgacgag
ccgggtttcacccagccgctgatgtaccgcaagatccgcgcccacaaatcgacgctggag
ctgtactccgccaagctcgaggccgagggcgtgattcaagcaggcgaactcgacgagatg
cgcgcggcctggaaggccagactcgaaatcgagttcgaagccggccaggccttcaagccg
aacaaggccgactggctcgacggccgctgggccggcatgaaggcgatccgtgccgacgag
gacgatccgcgtcgcggcgcgaccggtgttcccgccgccgtgctcaaggaaatcaccgag
aagatcacgtcggttccgccgggcttcaacgtccacaagacgatccagcgctttctcgac
aaccgccgcaaggcgatcgagaccggcaagggcatcgactgggccaccgccgagtcgctg
gccttcgggtcgctgctgctcgacggcaacccggtccgcctgtcgggccaggacagtgag
cgcggcaccttctcgcagcgccattcggtgctgatcgaccaggaaaccgaagcgcgccac
acctcgctgaaccatatccgcgagggccagtcgcgctacgaggtcatcaactcgatgctc
tcggaagaggcggtgctgggcttcgaatacggctacaccctgtcggagcccaacgcgctg
acctgctgggaagcgcagttcggcgacttcgccaacggcgcgcaggtgctgttcgaccag
ttcatctcgtcgggcgagcgcaaatggctgcgcatgtcgggtctggtctgcctgttgccg
catggctatgagggccagggccccgagcactcctcggcgcgcctggagcgcttcctgcag
atgtgcgcggaagacaacatgcaggtggcgaactgctcgacgccggcaagctatttccac
atcctgcgccggcagctcaagcgcgatttccgcaagcccctgatcctgatgacgccgaag
tcgctgctgcgccacaagcgctgcgtctccgatctggccgacattgcggagggctcgacc
ttccaccgcgtgctgcatgacgacgccgagcgcggcagctcctcgaccaagctggtcaag
gattccaagatccgtcgcgtcgtgctgtgctcgggcaaggtctatttcgacctgctggag
gatcgcgagaagcgcggcatcgacgacgtctatctgatgcgcgtcgagcagctctatccc
ttcccgctgaagtcgctggcgcaggagctggcgcgcttcaagggcgccgacgtggtctgg
tgccaggaggaacccaagaacatgggctcctggaccttcgtcgagccctatctcgaatgg
gtgctcggccatgccggcgtgaagtcgaagcgggcgcgctatgtcggccgcccggcctcg
gctgcgacagcgaccggcctgatgtccaagcaccttgcccagctcaacgcgttcctcgac
gaggcctttgcggcctga

DBGET integrated database retrieval system