KEGG   Bosea sp. PAMC 26642: AXW83_18140Help
Entry
AXW83_18140       CDS       T04264                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bop  Bosea sp. PAMC 26642
Brite
KEGG Orthology (KO) [BR:bop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXW83_18140
Enzymes [BR:bop01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AXW83_18140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AMJ61961
UniProt: A0A126P225
LinkDB All DBs
Position
3769981..3770691
Genome map
AA seq 236 aa AA seqDB search
MPSDTDASLDLYYWPTPNGWKISIMLEECGLPYNLKLIDIGAGEQFSDDFLKISPNNKIP
AIVDRDGPGGRTVSVFESGAILQYLGRKTGKLYPEDPVVRGVVEEWLYWQVGGFGPMLGQ
THHFLVYAKESVPYAIDRFTREAARLYGVMDKRLAQSEYLAGDYSVADIACVGWASLYER
QKQDITHFPNVKRWLDKLLSRPAVQRGLALARENRKDSAFKDPKAHAILFGSKPAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggataccgatgcctcgctggatttgtattactggccgactccgaatggctgg
aagatttccatcatgcttgaggaatgcggcctgccctacaacctcaaactgatcgacatc
ggtgcaggcgagcaattttcggacgacttcttgaaaatctcgcccaacaacaaaattccg
gcgatcgtcgacagggacggccctggaggtcgaacggtgtcggttttcgagtcaggtgca
attctccaatacctcggccgaaaaacgggcaagctttatccggaggatcctgttgtccgg
ggcgtcgtggaagagtggttgtactggcaggttggcggatttggacccatgctgggccag
acgcaccatttcctcgtctatgccaaggagagcgtcccctatgccattgatagatttacg
agagaagctgcacgcctgtacggtgtaatggacaagcgtttggcgcaatcggagtatttg
gctggagattactcggtcgcagacatcgcttgtgtgggctgggcaagtctctacgagcga
cagaagcaggacattacgcattttccgaacgtcaagcgttggctcgataagttattgtcg
cggccggcggtgcagcgcggcctggctttggcccgcgagaaccgtaaggacagtgcgttc
aaggatcctaaggcgcacgccattctcttcggaagcaagccggccgggtga

DBGET integrated database retrieval system