KEGG   Bosea sp. PAMC 26642: AXW83_19720Help
Entry
AXW83_19720       CDS       T04264                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXW83_19720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bop02000]
    AXW83_19720
Enzymes [BR:bop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AXW83_19720
Transporters [BR:bop02000]
 Other Transporters
  Pores ion channels [TC:1]
   AXW83_19720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AMJ62227
UniProt: A0A126NZ71
LinkDB All DBs
Position
4092061..4092693
Genome map
AA seq 210 aa AA seqDB search
MSDELVLYTNPMSRGRIARWMLEEVGQPYRAEVLGFGPAMKGDYQRLNPMGKVPTLQHGD
VVVTECAAICAYLADAFPEAGLAPPPTSRLRGPYYRWMFFAAGPVEAAVTNRALGVEVSD
EKSRMVGYGNFAAVMDTLELAVTQGEYLLGDSFSAADVYLGSQVMWGLKFGSMEKRPAFE
AYARRLGARPAAQKADAIDDALIAEMKQAG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaactcgtgctctacaccaacccgatgtcgcgcggccggatcgcccgctgg
atgctggaggaagtcggtcagccctatcgcgccgaggtcctcggtttcggcccggcaatg
aagggcgactaccaacggctgaacccgatgggcaaggtgccgacgctgcagcatggcgac
gtcgtcgtcactgaatgcgcggcgatctgcgcctaccttgccgatgcctttcccgaggcg
gggcttgcgccgccgccgaccagccggctgcgcgggccctactaccgctggatgttcttc
gccgccggtccggtcgaggccgccgtgacgaaccgagcgcttggcgtcgaggtctccgac
gagaagagccgcatggtcggctacggcaatttcgccgccgtgatggatacgctcgaactt
gcggtgacgcagggcgagtatctgctcggcgacagcttcagcgcggccgatgtctatctc
ggctcacaggtgatgtgggggctgaagttcggctcgatggagaagcgcccggccttcgag
gcctatgccaggcgtctcggcgctcgaccggcggcgcagaaggccgacgcgatcgacgat
gcgctgatcgccgagatgaagcaggcggggtag

DBGET integrated database retrieval system