KEGG   Bosea sp. PAMC 26642: AXW83_25220Help
Entry
AXW83_25220       CDS       T04264                                 

Definition
(GenBank) peptidase
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AXW83_25220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bop02000]
    AXW83_25220
Enzymes [BR:bop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     AXW83_25220
Transporters [BR:bop02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    AXW83_25220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers GAF_2 GAF GAF_3 SpoVT_C
Motif
Other DBs
NCBI-ProteinID: AMJ63163
UniProt: A0A126P2M7
LinkDB All DBs
Position
5267748..5270015
Genome map
AA seq 755 aa AA seqDB search
MRGALGGPGVLLRRLREVMAASISPQERLDRLVVLIAGNLIAEVCSVYVLREDGSLELYA
TEGLNREAVHLTTMRAGEGLVGLIAREAEPVALSDAQAHPAFSYRPETGEEIYHSFLGVP
ILRGGAVMGVLVIQNRATRLYSEEEVESLQTTAMIMAEMIAAGGLKSLAAPGASIGLDRP
IHGIGASLADGVGLGHAVLHEPRVAITNLIAENPASEVRRLEAAIAEMRASIDELIERGD
VAHTGEHRDVLETFRMFAHDQGWLRRMREVVMTGLTAEAAVERVQSDTRAKMLRQTDPYL
RERLHDLDDLANRLLRTLVGKANGVAREQLPENAILIARSMGPAALLDYDRAHLRGLVLE
EGGPTSHIAIVARALGIPAVGEIVNATALIQSGDAVIVDGQAGEVQIRPQPDVENAYKDK
ARLRARKQEQYRKLKTQPAITKDGVPVVLQINAGLLVDMPNLEATAASGIGLFRTELQFM
VAQHMPTTSEQQQLYSAVLDQAQGRPVTFRTLDIGGDKVLPYMERVEEENPALGWRAIRI
GLDKPRLLRAQLRALLRAGAGRDMKIMLPMVATVDEFQRARVLMQREQAMLAKQGHEPPL
SLRLGVMVEVPSLLFELPEIAREADFLSIGTNDLMQFLFAADRENKRVSDRFDPLGVSAL
RALRSIVDAAAEASCPVTVCGEMGGKPLETMALIGLGYRAFSMSAAAIGPIKAMLRALDT
GKLRERMDWMLASPDGSASLRPQLAAFAAEFKVPV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcgctctcggaggaccaggcgttctgctgcgccgcctccgcgaggtgatggca
gcgtcgatcagcccgcaggagcggctcgaccggctcgtcgtcctgatcgccggcaatctg
atcgctgaagtctgctcggtctacgtcctgcgcgaggacggctcgctcgagctctacgcc
accgaaggcctcaaccgcgaggcggtccacctgacgaccatgcgtgcaggggaaggcctc
gtcggcctgatcgcgcgcgaagccgagccggtcgcgctttcggacgcgcaggcccatccg
gccttctcctaccggcccgaaacgggtgaggaaatctaccactccttcctcggcgtaccg
attctgcgcggcggcgccgtgatgggcgttctcgtcatccagaatcgtgcgacgcggctc
tacagcgaggaggaggtcgaatcgctgcagaccaccgccatgatcatggcggagatgatc
gcagccggcggcctcaagtcgctagccgcccccggggcctcgatcgggctcgaccgtccg
atccatggcatcggcgcgtcgcttgccgacggcgtcggtctcggccacgcggtgctgcac
gagccgcgggtcgccatcaccaacctcatcgccgagaatcctgcgagcgaggtcaggcgg
ctggaagcggcgatcgcggaaatgcgtgcctcgatcgacgaactgatcgagcgcggcgac
gtcgcccataccggcgagcatcgcgacgtgctcgagacatttcgcatgttcgcccatgat
cagggctggctcaggcggatgcgcgaagtcgtcatgaccggcctcacggccgaggccgcc
gtcgaacgcgtacaatcggatacgcgcgcgaagatgctgcgccagaccgacccctatctg
cgcgagcgcctgcacgacctcgacgatctggccaaccggctgctgcggacgctggtggga
aaggctaacggcgttgcgcgcgagcaattgcccgaaaacgccatcctgatcgcgcgttcg
atggggcctgctgcactgctcgactacgaccgcgcccatctgcgcggcctcgtgctggag
gaggggggccccaccagccatatcgcgatcgtggcgcgcgcgctcggcatcccggcggtc
ggtgaaatcgtcaatgccaccgcgctgatccagtcgggcgatgcggtcatcgtcgacggg
caggccggcgaggtccagatccggccgcagcccgatgtcgagaatgcctataaggacaag
gcgcggctgcgtgcccgcaagcaggagcagtaccgcaagctcaagacgcagcccgcgatc
accaaggatggtgtcccggtcgttctgcagatcaatgcgggcctgctggtggatatgccc
aacctcgaggccaccgcggcctccgggatcggcctgttccgaacggaacttcagttcatg
gtcgcgcaacacatgccgaccaccagcgaacagcagcagctttacagcgcggtgctcgac
caggctcaagggcggcccgtgacctttcgcacgctcgatatcggcggcgacaaggtgctg
ccctatatggaacgcgtcgaggaagagaatccggccctgggctggcgcgcgatccgcatc
ggcctcgacaagccgcgcctgctgcgcgcgcaactgcgcgcccttttgcgcgctggcgcc
ggccgcgacatgaagatcatgctgccgatggttgcgacggtggacgaattccagcgtgcg
cgcgtgcttatgcagcgcgagcaggcgatgctggccaagcagggtcatgagccgccgctc
agccttagactgggcgtcatggtcgaggtgccctcgcttctcttcgaactgccggaaatc
gcgcgagaagccgatttcctctcgatcggaaccaatgatctgatgcagtttctgttcgcg
gccgaccgcgagaacaagcgggtctcggaccgattcgatccgctcggcgtcagcgcgctc
agggcgctccgcagcatcgtcgatgcggccgccgaggcgagttgcccggttaccgtctgt
ggcgagatgggcggcaagccgctggagacgatggcgctgatcgggctgggctatcgcgcc
ttctcgatgtcggcggccgcgatcggcccgatcaaggctatgctgcgtgcgctcgatacc
ggcaagctgcgcgagcgcatggactggatgctggcctcgcccgacggttccgccagcctg
cggccccagcttgcggcgtttgcggcagagttcaaggttccggtctag

DBGET integrated database retrieval system