KEGG   Bipolaris oryzae: COCMIDRAFT_108460Help
Entry
COCMIDRAFT_108460 CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bor  Bipolaris oryzae
Pathway
bor00020  Citrate cycle (TCA cycle)
bor00190  Oxidative phosphorylation
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01130  Biosynthesis of antibiotics
bor01200  Carbon metabolism
Module
bor_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCMIDRAFT_108460
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    COCMIDRAFT_108460
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     COCMIDRAFT_108460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19119251
NCBI-ProteinID: XP_007692911
JGI: Cocmi1_108460
UniProt: W6YYE1
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSCLRMRRMQLASQLARSFRPSTRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQ
YDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFGGQSQKYG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFATDLIMEDGVCKGVVAYNQED
GTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDMEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTQDAQGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFSPGQT
ADPVSADAGADSIAVLDKVRTSEGTKSTAEVRLQMQKVMQTDVAVFRTQESLDEGVKKIH
EVDADFVNVGIKDRSMIWNSDLVETLELRNLLTCAVQTAESAANRKESRGAHAREDYPDR
DDEQWMKHTLSWQKKPHGETKLGYRAVTGTTLDEAECKAVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtctcaggatgcgtcgcatgcagcttgcgagccagctcgcgaggagtttccgc
ccaagcacacgtgctttctcctcaactcgacccttccaacgtataatcgctaccgagaac
ctgcgagcaaaggaggcgtcaggcttcatctccagcaagtaccccgttattgatcaccaa
tacgatgccattgttgttggcgctggaggcgctggtctgcgagcagctttcggtctcgct
gaggcgggcttcaacacggcctgtatttcaaagcttttccccactcgatcgcacacggta
gctgcgcagggcggtatcaatgcggcactcggaaacatgcacgaagatgactggaggtgg
cacatgtacgataccgtcaaaggttcagattggcttggtgaccaggatgctatccactac
atgacaagagaggccccacagtctgtcattgagctcgagaactacggttgcccattctcc
agaaccgacgacggcaagatttaccaacgtgcctttggtggtcaatcgcaaaagtacgga
aagggtggacaggcataccgatgctgtgctgctgctgacagaactggtcacgctctccta
cacaccctctatggacaatctctccgccacaacaccaagtacttcattgagttcttcgct
accgatttgatcatggaagatggcgtctgcaagggtgtcgttgcctacaaccaggaagac
ggaactatccaccgtttcatcgctaagaacaccgttttggccactggtggttacggacgt
gcttacttcagctgcacatcggctcacacctgtactggtgacggtatggctatggttgct
cgcgcaggtctccccaaccaggacatggagttcgtccagttccaccccactggtatctat
ggcgctggatgcttgatcactgagggttcccgtggagagggtggttaccttctcaactcc
gagggtgaacgattcatggagcgttatgcacccactgccaaggatcttgcctcccgtgac
gttgtttcccgatcaatgactctggaaatccgtgaaggccgtggtgtgggtcccgaaaag
gatcacatctaccttcagctcagccacctgcctcctgaggtcctccacgagcgtctgccc
ggtatctccgagaccgctgccattttcgccggtgtagatgttaccaagcagcctattccc
gtccttcccactgtccactacaacatgggtggtatccccaccaagtacactggtgaggtt
ctcactcaagacgcccagggtaaggaccaagtcgtacctggtctgttcgcttgcggtgaa
gctgcctgcgtatctgttcacggagccaaccgtctcggtgccaactcattgctcgacctt
gttgtctttggtcgcgctgtttcccacactatccgcgacaacttcagccccggtcagacc
gctgaccccgtatctgccgatgctggcgccgactccattgccgtcctcgacaaggtccgt
acctccgagggcaccaagtccaccgccgaagtccgcctacagatgcaaaaggtcatgcag
accgatgtcgccgtcttccgaacacaagagtcgctcgacgagggtgtcaagaagatccat
gaggttgatgccgactttgtcaacgttggtatcaaggaccgcagcatgatctggaactcc
gaccttgtcgagactcttgagctacgaaacttgcttacttgcgctgttcagactgctgaa
tctgctgccaaccgcaaggagtcgagaggcgcccacgcccgcgaggattaccccgatcgt
gacgacgagcagtggatgaagcacaccctgtcgtggcagaagaagccacacggcgagacc
aagcttggctacagggcggtaactggtactacactagacgaggccgagtgcaaggctgtg
ccaccattcaagcgtacctactag

DBGET integrated database retrieval system