KEGG   Bipolaris oryzae: COCMIDRAFT_108688Help
Entry
COCMIDRAFT_108688 CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bor  Bipolaris oryzae
Pathway
bor00020  Citrate cycle (TCA cycle)
bor00480  Glutathione metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01130  Biosynthesis of antibiotics
bor01200  Carbon metabolism
bor01210  2-Oxocarboxylic acid metabolism
bor01230  Biosynthesis of amino acids
bor04146  Peroxisome
Module
bor_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCMIDRAFT_108688
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCMIDRAFT_108688
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCMIDRAFT_108688
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     COCMIDRAFT_108688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19119292
NCBI-ProteinID: XP_007692991
JGI: Cocmi1_108688
UniProt: W6YS85
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MRPAIAAPAAIRHASSIAHLSRRQTCAFATRCLASHSPATSAQLLSPRRPATVTARTTPT
SLYTLAAQHRMASSSPVKKIKVKNPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDL
GLPYRDETDDQVTLDAAEAIKKYSVGVKCATITPDEQRVEEFKLKKMWLSPNGTIRNHLG
GTVFRAPIVIPTIPRLVPGWKQPIIIGRHAFGDQYRAKDRVIPGEGTLEMVFTPKGGKPE
VIKVYDFPAEGGVAQTQYNTTESISGFAHASFKMALDKKLPLYMSTKNTILKAYDGKFKD
VFQEIYDTQYKKDFEAANIWYEHRLIDDMVAQMIKSEGGYVIAMKNYDGDVQSDIVAQGF
GSLGLMTSTLITPDGKTFEAEAAHGTVTRHYREHQKGKETSTNPIASIFAWTQGLAKRGE
LDNTPELVVFAETLEKACIDTVDVDKIMTKDLALACGKKDRASWVTTNEYLDAVERRLKS
SLKEKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggcaattgctgcccccgcggctatccgccatgcatcttcaattgcgcatctc
tcccgtcgccagacttgtgcttttgcaactcgctgtttagcttctcactcgcctgcgaca
tcggcccaacttttgagcccgcgacgaccagcaacagtcactgccagaacaacgcccacc
agcctatacactctcgccgcacagcacagaatggcgtcgtcttccccggtcaagaagatc
aaggtcaagaaccccgtcgtggagctcgacggtgatgagatgaccaggatcatctggcag
gtcatcaaggacaagtttatccacccttaccttgacattgacctcaagtactacgacctg
ggtctgccataccgagatgagaccgacgaccaagtcacgctcgacgccgccgaggctatc
aaaaagtactcggttggtgtcaagtgcgcaaccattaccccagacgagcagcgtgtagaa
gagttcaagctcaagaagatgtggttgtcgcccaatggcaccattcgaaaccatctagga
ggaaccgtcttccgcgcacccattgttatccccaccatccctcgtctcgtccctggatgg
aagcagcccatcatcattggccgccacgctttcggcgaccagtatcgcgccaaggaccgt
gtcattcccggtgagggaaccctggaaatggtcttcacaccaaagggcggcaagcccgag
gtgatcaaggtctacgacttccctgccgaaggcggcgtcgcccagacccagtacaacaca
accgagtccatctcgggcttcgcacatgcctcgtttaagatggcgctcgacaagaagctg
cctctgtacatgagcaccaagaacaccattctcaaggcctacgacggaaagttcaaggat
gtcttccaggaaatctacgacacacagtacaagaaggattttgaggccgccaacatctgg
tacgagcaccgtctgattgacgacatggtcgctcagatgatcaagagcgagggtggctac
gttattgccatgaagaactacgatggagacgtccagtcagacattgtcgctcagggtttc
ggctctcttggtctcatgacttccacactcatcactccagacggcaagacgttcgaggct
gaggccgcacacggtaccgttacccgccactaccgcgagcaccaaaagggcaaagagaca
tctactaaccccattgcctccatctttgcctggacgcaaggtctggccaagcgtggcgag
ctcgacaacacccctgaacttgtcgtctttgccgagacgctcgagaaagcttgcatcgac
acggtcgatgttgacaagatcatgaccaaggatctagcgctagcgtgcggaaagaaggac
agggctagctgggtcacaaccaacgagtacttggatgcggtagaacgaaggctcaagtcg
agtttgaaggaaaagctataa

DBGET integrated database retrieval system