KEGG   Bipolaris oryzae: COCMIDRAFT_109402Help
Entry
COCMIDRAFT_109402 CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bor  Bipolaris oryzae
Pathway
bor00250  Alanine, aspartate and glutamate metabolism
bor00410  beta-Alanine metabolism
bor00430  Taurine and hypotaurine metabolism
bor00650  Butanoate metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
Module
bor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    COCMIDRAFT_109402
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCMIDRAFT_109402
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCMIDRAFT_109402
   00430 Taurine and hypotaurine metabolism
    COCMIDRAFT_109402
Enzymes [BR:bor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCMIDRAFT_109402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 19119423
NCBI-ProteinID: XP_007693273
JGI: Cocmi1_109402
UniProt: W6YXF8
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MVHINRVATFKEISEERARFDDIATTSTINLSPDDEVDDFTATVYGSKYAAEDLPKYEMP
EREMPPQVAYRMIKDDLTLDGTPTLNLASFVTTYMEEEVEKLMVDAFSKNFIDYEEYPVS
ADIQNRCVSMIARLFNAPSTDDANIIGTSTIGSSEAIMLGVLAMKKLWQNKRKAEGKPYD
KPNMVMNSAVQVCWEKACRYFDIEEKYVYCTADRYVIDPKECVDLCDENTIGICAILGTT
YTGEYEDIKAINDLLVERDIDVNIHVDAASGGFVAPFVNPGLLWDFRLPKVTTINASGHK
YGLVYPGVGWVVWRDPQYLPQELVFNINYLGADQASFTLNFSRGASQIIGQYYQLIRLGK
RGYRRIMLNLTRTADYLAANLESMGFVIMSQRGGEGLPLVACRIDEDLGKQYDEFAIAHQ
LRERGWVVPAYTMAPHSEKMKMLRVVVREDFTKSRCDALIADFKLALQTLDALDAKRIQE
HKEHQFAMRRRSTLVSPVFQKKATDHFEENHSLQAKTGKTHAVC
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacatcaaccgcgtagctaccttcaaggagatttccgaggagagggctcgattc
gacgacattgccactacaagcaccatcaacttgagcccagacgatgaggttgatgacttt
actgcaaccgtctatggtagcaagtatgctgccgaggacctaccaaaatatgagatgccg
gagcgggaaatgccccctcaggtggcctaccggatgatcaaggacgacctcacactcgac
ggaacaccaacactgaacttggcctctttcgtcaccacatacatggaggaggaagttgag
aagctcatggtcgacgccttttccaagaacttcatcgattacgaagaataccccgtcagc
gccgacatccaaaaccgatgtgtctctatgattgcgagactcttcaatgctccaagtaca
gatgatgcaaacatcatcggtacttcgacaattggatcttccgaggccatcatgctggga
gtattggccatgaagaagttgtggcaaaacaagcgaaaggcagagggaaagccatacgac
aagcccaacatggttatgaactcggctgtgcaggtttgctgggagaaagcgtgccgatac
ttcgacattgaagaaaaatacgtctactgcacagctgatcgctacgttatcgaccccaag
gaatgcgtagatctgtgtgacgaaaacaccatcggcatttgtgcaattctcggaaccaca
tacactggcgaatacgaagacatcaaagccatcaatgaccttctggtcgagcgagacatt
gatgtcaacatccacgtcgatgctgcttcgggtggctttgttgctccttttgtcaacccc
gggcttctctgggacttccgtcttcccaaggtcacaaccattaacgcctcaggacacaaa
tacggcctcgtttaccccggtgttggctgggtcgtctggcgcgatccccagtatctgccc
caagaactcgttttcaacatcaactacctaggtgccgatcaggcgtcctttacgctcaac
ttctcacgtggcgcttcacagattatcggccaatactaccaactcattcgtctaggaaag
cgtggctacaggaggataatgctgaacctgacgcgcactgctgactacctagctgcaaac
cttgaatccatgggtttcgtcatcatgagccaacgtggaggagaaggactccctcttgtc
gcatgccgcatcgacgaggatctcggcaagcagtacgacgagtttgccattgcacatcag
cttcgtgagcgtggatgggttgtgcctgcctacaccatggctcctcactcggagaagatg
aagatgttgcgtgtcgttgttcgcgaggactttaccaaatcacgatgtgatgctttgatt
gcagacttcaagctagcactgcaaactcttgacgcactggacgccaagagaatccaagag
cacaaggaacaccagttcgcgatgcgccgccggtcgacgctcgttagccccgtctttcaa
aagaaggcgacggatcattttgaagagaaccacagtctgcaggccaagaccggcaagacg
catgcggtttgctaa

DBGET integrated database retrieval system