KEGG   Bipolaris oryzae: COCMIDRAFT_21917Help
Entry
COCMIDRAFT_21917  CDS       T03125                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bor  Bipolaris oryzae
Pathway
bor00500  Starch and sucrose metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCMIDRAFT_21917
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     COCMIDRAFT_21917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19120137
NCBI-ProteinID: XP_007682825
JGI: Cocmi1_21917
UniProt: W6ZKS0
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MLPRVFLLTGFVHHAYTLSIPRLPSLTTFSASSRVQQQQPLQDTLDAWIKHEERIALDKL
LANVAPGGSNVQGKGVAEGTVIASPSQDGPDYWFQWVRDAAITMDTLVNIYADDTSSSRA
ASLSTILDAYTSLQGDIQRTSNPSGTFDDLSGLGEPKFQVDGKPFTGSWGRPQRDGPALR
ALTLMHYLREYNASHPSLWSSPDSEDFFSSFYTAEMPPRSIIKADLEYVSHFWNQSGFDL
WEEVEGLHFFTLMVSARSLKEGSHLARIFGDNGAADWYQKQAGYIENLLGKFWNAQKGHL
VETLWSKRSGLDCGLLLGSLHALPKSGSEDDVVYPPWSDEILVSLLALTRDQRDRFPINS
NPSDQDDDDDNVDEFTFQGTGLGRYPEDVYDGYGNSNRGGNPWFLCTSSAAEILYRTASH
IVATGNLTITDVGLPFYESLLGSSSLDVDVGSFGPTDALFHSVIERLHSTGDEFLHVVKA
HVDAEGSMSEQFDRVTGYMRGAQHLTWSYGAFLQAARARKIPVH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctacctcgcgtgttcctcctcacaggcttcgtccaccatgcctacacattatcaata
cctcgtcttccttccctcaccactttttctgcttccagccgtgtgcagcaacagcaaccg
cttcaagacacgcttgatgcctggataaagcatgaagagcgcatagcactggacaaactg
cttgccaacgttgcgcctggaggtagcaatgtccaaggaaaaggtgtggctgaaggcacc
gtcatcgccagccccagtcaagacggtccagactactggttccaatgggtccgtgacgct
gctatcaccatggataccctcgtcaacatctatgccgacgatacttcatcctcacgcgcg
gcttctctatccaccatcctagacgcctacacctccctccaaggtgacattcagcgcact
tcaaacccgtctggcacatttgacgacctttccggactcggtgaacccaagttccaagtc
gatggcaagccgttcaccggctcgtggggacgacctcagcgcgatgggccggcccttcgc
gcactgacgctcatgcattatctccgcgagtacaacgcatcgcatccctcgctatggagc
tcccccgactccgaagacttttttagttcattctacaccgctgaaatgccccctcgtagc
atcatcaaggcagatctcgagtatgtcagccatttctggaatcagtcgggattcgatctc
tgggaggaggtcgagggcctgcacttcttcaccctcatggttagtgcgaggagtctgaag
gagggcagtcaccttgccagaatctttggagacaacggcgcggcggattggtaccaaaag
caagctggctacattgagaacctattgggcaaattctggaacgcgcaaaaaggacatctt
gttgagacgctgtggagcaagaggagcggcctcgactgcggactgcttctcggctctttg
cacgcccttcctaagagcggatcggaagacgatgtcgtgtatcctccgtggtctgacgag
attcttgtgtctctgcttgctttgactcgggaccagcgcgaccgtttccccatcaacagc
aacccttctgaccaggatgacgatgatgacaacgtagacgagttcacattccagggaacg
ggcctcggccgttatcctgaagatgtatacgacggctatggaaactcgaaccgtggtgga
aacccatggttcctgtgcacctcttccgctgccgagattctgtaccgcaccgcctcgcac
attgttgccactggcaacttgactattactgatgttggtcttcccttttacgagtctctc
ctcggtagctcctctctagatgtcgacgttggctctttcggccccacagacgccctcttc
cactctgtcatcgagcgcctccatagcaccggcgacgagtttttgcatgtcgtcaaggcg
catgtggatgccgagggtagcatgagtgagcagtttgaccgtgtgactggatacatgcgt
ggtgctcagcatttgacttggagttatggtgcctttttgcaggctgctagagcaagaaag
attcctgtgcattag

DBGET integrated database retrieval system