KEGG   Bipolaris oryzae: COCMIDRAFT_27882Help
Entry
COCMIDRAFT_27882  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bor  Bipolaris oryzae
Pathway
bor03030  DNA replication
bor03410  Base excision repair
bor03420  Nucleotide excision repair
bor03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    COCMIDRAFT_27882
   03410 Base excision repair
    COCMIDRAFT_27882
   03420 Nucleotide excision repair
    COCMIDRAFT_27882
   03430 Mismatch repair
    COCMIDRAFT_27882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bor03032]
    COCMIDRAFT_27882
   03400 DNA repair and recombination proteins [BR:bor03400]
    COCMIDRAFT_27882
Enzymes [BR:bor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     COCMIDRAFT_27882
    6.5.1.6  DNA ligase (ATP or NAD+)
     COCMIDRAFT_27882
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     COCMIDRAFT_27882
DNA replication proteins [BR:bor03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    COCMIDRAFT_27882
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     COCMIDRAFT_27882
DNA repair and recombination proteins [BR:bor03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     COCMIDRAFT_27882
   NER (nucleotide excision repair)
    Other NER factors
     COCMIDRAFT_27882
   MMR (mismatch exicision repair)
    Other MMR factors
     COCMIDRAFT_27882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF5427
Motif
Other DBs
NCBI-GeneID: 19121198
NCBI-ProteinID: XP_007689794
JGI: Cocmi1_27882
UniProt: W6Z811
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MNSPSKRRKKNDGSGKPVRSLDYFFAKQAAKATPKDAPTDPTSSGAPAEQDYSGLTDEEL
ARKLQEQWDKEDRERGQNVAPVSSNELYEEPEKPTTNTGANEGSGNVKKSESPTRDVTME
EIPELAPAPKKNTLTLQSTASEEDTITANIPFDQSPLEFDPAEYIPDLKKHWVTDGGHAT
YALLTRCFILINSTTSRIKIVDTLVNLLRTIIESDPSSLLPAVWLSTNAISPPYIDLELG
LGGSAISKALKKVCGLDNASLKALSSKHGDAGDVAFEAKKKQSFTLRKPKPLTIKSVFDS
LVKIANSKGNGSVENKQRIVERLVQDARGAEESRYVVRTLVQHLRIGAVKTTMLIALSRA
FMLSKPPGAEFEIRDRKDMAKMKKEELVEIYSRNEEIVKACFARRPNYNDLIPVLLEIGV
GDELLVRCGLALHIPLRPMLGSITRDMGEMLTKLQGRDFACEYKYDGQRAQVHCDSKGKV
TIFSRHLEVMTDKYPDLVALVPKIRGEGVSSFILEGEVVAVDRESGDLKPFQTLANRARK
DVVIGTVTIDVCLFAFDLMYLNGEELLNRPFRERRSLLRSLFVEIPHHFTWVKSLDATSA
DVEAVQSFFQSALDIKCEGIMVKVLDNLPNPDLLAEIDEPGLEKTPSLPPTPRKKKPSKS
KAKAKSTDAETDEPKVSGRRKALLSTYEPDKRLDSWLKVKKDYSTTSETLDLIPIAAFHG
SGRKAAWWSPILLAIRNAETGQLEAVTKCMSGFSDAFYKANRAKYDPGDADSTTVLPGKP
HYVEYNGGAGMPAVWFEPQEVWEVAFADLTLSPTYTAAIGLVSDERGLSTRFPRFLRVRE
DKSIEEATEAEELASLYRKQEAKAPKKNDGGGGGREVEDEDME
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccgtcgaagcgtagaaagaagaatgatgggtcaggaaagccagttcgtagc
ttagactacttcttcgcaaagcaagcggcaaaagcgacacccaaagatgcgcctacggat
cctacgtccagtggagcgcctgcagagcaagattactcggggttgacggacgaagaactt
gcccgcaaactccaggaacaatgggataaggaagatcgcgaaagaggtcagaatgtggcg
cctgtaagctcaaatgagttgtatgaagagccggagaagcctactacgaatacgggggcg
aatgaaggttcaggcaatgtaaagaaatccgaatcaccaacccgtgacgttactatggag
gaaatacccgaactcgcgcctgcgccgaagaaaaatactctcacgcttcaatcaaccgca
tccgaagaagatacaataaccgcaaatatacccttcgaccaaagcccgcttgaattcgat
ccagcagaatatatacccgacttaaaaaagcattgggtaacagatggggggcatgcgacc
tatgctcttctgacaagatgtttcattctgatcaatagcaccacgagtcgcatcaagatt
gtagatactcttgtcaacctgctacggacaattatcgagagtgacccaagtagcctactc
ccggctgtgtggctttccacgaacgcgatatctccaccgtatattgatcttgagctagga
cttggagggtccgcgatctccaaggcgctgaagaaggtgtgcggactagacaacgcaagc
ctgaaggcgttgagcagcaagcatggagacgctggcgatgtggcatttgaagcaaagaag
aagcagtcgtttacccttcgcaaaccaaaacccttgaccatcaagagcgttttcgactcg
ttggtcaagattgcgaatagcaagggaaatggcagtgttgaaaacaagcaaagaattgtc
gagagactagtccaagatgcaagaggtgcggaagaaagtcgctatgttgtacgaaccttg
gtgcagcatttgcgtataggcgctgttaagacgacgatgctcattgcattatctcgagca
ttcatgctgtcgaaacctccaggcgccgagtttgagattcgcgatcgaaaagacatggca
aaaatgaagaaggaggagttggttgagatttacagcagaaacgaggaaatcgtcaaagca
tgttttgcccggagaccaaactacaacgaccttatacctgtacttctcgagattggcgtc
ggtgatgagctgctcgtgcgttgcgggctagcccttcacattcctcttcggcctatgttg
ggtagcataacgcgcgacatgggcgagatgctcaccaagctgcaaggccgcgattttgct
tgtgaatacaagtacgatggacaacgagcacaggtccattgcgactcaaagggcaaagtc
acaatcttttcgcgacacctggaagtcatgacggacaagtatcccgacttggtggcgctt
gtacccaagatacggggcgaaggcgtgtcgagctttatcctcgaaggtgaagtggtagcc
gttgatcgagagagtggtgacctcaagccgttccagacactagccaatcgcgcaagaaaa
gatgtggtcatcggaacagtgacaatcgacgtctgtctcttcgcattcgatctcatgtac
ctcaacggcgaggaacttcttaaccgacccttcagagagcgaagatcgctactgcgaagc
ctgtttgtcgaaattccccaccacttcacctgggtcaaaagcctcgatgccacatcagcc
gacgtagaagccgtccagtccttcttccaaagcgccctggacatcaaatgcgaaggtata
atggtcaaagtcctcgataacctccccaacccggatctcctcgccgagatagatgaaccc
ggtctcgaaaagacgccctcgctgccccctacacccaggaaaaagaaacccagtaaatca
aaagcaaaagccaaatcgacagacgctgaaacagacgagcccaaagtctcgggccgccgc
aaagccttgctatcaacatacgagcccgataaacgcctcgactcatggctcaaggtaaag
aaggactacagcaccacctcggaaaccctcgatctaatccccattgcggcattccatggg
tcaggccgaaaggcagcatggtggtccccgatcctcctcgcaatccgcaacgcagaaaca
ggccagctcgaggccgtcacaaagtgcatgtctggcttcagcgacgccttctacaaggcc
aaccgcgccaagtacgatcccggagatgccgactcgactaccgtgttacccggtaagcca
cactatgtggagtacaatggtggggcgggcatgccggccgtgtggtttgagccacaggag
gtgtgggaggtggcttttgcggatttgacgcttagtcctacgtacacggctgcgattggg
ctggtgagcgatgagcgtgggctgagtacgaggtttccgcggttcctgcgggtgagggaa
gataagagtattgaggaggcgacggaagcggaggagttggcgagtttgtataggaagcag
gaggccaaggcgccaaagaagaacgatggtggtggtggtgggagagaagtggaagatgag
gatatggagtag

DBGET integrated database retrieval system