KEGG   Bipolaris oryzae: COCMIDRAFT_33735Help
Entry
COCMIDRAFT_33735  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bor  Bipolaris oryzae
Pathway
bor00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCMIDRAFT_33735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bor02000]
    COCMIDRAFT_33735
Enzymes [BR:bor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCMIDRAFT_33735
Transporters [BR:bor02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCMIDRAFT_33735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 19122393
NCBI-ProteinID: XP_007684630
JGI: Cocmi1_33735
UniProt: W6ZAT0
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MSQQSDITLYTTQTPNGIKISITLEELGLPYKVHKIDISKNTQKEDWFLAINPNGRIPAL
TDTFTDGKPINLFESGSIMQYLVERYDTEHKISFPKGSREWFEMNNWLFFQNAGVGPMQG
QANHFTRYAPEHIEYGVNRYQTETRRLYSVLDKHLASDNRPYLCGTKCTIADIAHYGWGA
AAGWAGVDLDKFPAVQAWLDRMEAREGVEKGRHVPDPHRMRELLKDKAKMEEQAAKSRAW
VQAGMKEDAEKQK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcaatctgatatcacgctttatacgacgcagacgccgaatggcatcaagatc
tccattaccttggaggagctgggcctcccctacaaagtccacaagatcgatatatccaaa
aacacccaaaaagaagactggttcctcgctatcaaccccaacggccgcatccccgcccta
accgacaccttcaccgacggcaaacccatcaacctcttcgagtccggcagcatcatgcag
tacctcgtcgagcgctacgacaccgagcacaagattagtttccccaagggctcgcgcgag
tggttcgaaatgaacaactggttgtttttccagaatgctggtgtgggacctatgcaggga
caggctaatcatttcacgcgttatgcccccgagcatatcgagtatggtgtgaataggtac
caaaccgagacacgccgtctctactctgtcctcgacaagcatctcgcttcggacaatagg
ccatacctgtgcggcacaaagtgcaccattgccgacattgctcactatggatggggagcg
gctgccggctgggcaggcgtcgacctggacaagttccctgccgttcaggcctggctggac
cgaatggaagcacgtgagggggtggagaaaggccgccacgtccctgatcctcacaggatg
agggagttgctcaaggataaggccaagatggaggagcaggctgctaagagtcgggcgtgg
gtccaggccggcatgaaggaagacgccgagaagcaaaagtag

DBGET integrated database retrieval system