KEGG   Bipolaris oryzae: COCMIDRAFT_93878Help
Entry
COCMIDRAFT_93878  CDS       T03125                                 

Definition
(RefSeq) carbohydrate-binding module family 20 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bor  Bipolaris oryzae
Pathway
bor00500  Starch and sucrose metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCMIDRAFT_93878
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     COCMIDRAFT_93878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase CBM_20 DUF1966
Motif
Other DBs
NCBI-GeneID: 19128345
NCBI-ProteinID: XP_007687427
JGI: Cocmi1_93878
UniProt: W6ZEY6
LinkDB All DBs
Position
Unknown
AA seq 587 aa AA seqDB search
MLLLKIFTALFFYITSIVSAADTNAWKSRSIYFVLTDRIARSSSDTGGSACSNLGNYCGG
TFKGLESKLDYIKGLGFDAIWITPVVSNKAAGYHGYWAEDLYAVNSNYGTAADLKSLVAA
AHAKGIYMMVDVVANHMGPGAITNNRPEPLNQASSYHTACNIDYSNQNSVEICQIAGLPD
INTTKSEIRTLLNTWVNWLVKEYSFDGVRIDTVKHVEKDFWPGFSAATGVYNIGEVFDGN
PSYLAEYAKLMPGLLNYAVYYPMNNFYQQKGSSQALVDMMNTVSNTFPDPAALGTFLDNH
DNKRWLNVKNDQTLLKNALAYVILARGIPILYYGTEQGYAGGDDPANREDLWRSGFNTNA
NLYQAIKKLTAARQAAGGLAGNDHVHLYVADTAYAWSRANGNLIVLTTNAGGNSNTQHCF
NTQKANGRWTNVYGNGATVTADGNGQICVSVTNGEPVVLLAGSATPTTGTTLTTRTTTAT
STSCPTAVSVSFTHRVTTVPGDTIKITGNTAQLGNWTPANGLTLSAASYTSSNPIWTITV
PLAAGSSISYKFVKINSGGTVTWESDPNRSYTAPSCQASASVNSSWQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgctcaagatctttaccgccctcttcttctacatcacctccatcgtctctgca
gcagacacaaatgcatggaagtcacgcagcatctactttgtcctgacggatcgtattgct
cgcagcagcagtgacacgggtggctcagcttgcagcaacctcggcaactactgcggtgga
actttcaagggcctcgagtctaagctcgactacatcaagggacttggattcgatgccatc
tggattacccccgtcgtctcaaacaaggctgctggataccatggctactgggccgaggac
ttgtatgccgtcaactcaaactacggcactgctgccgacttgaagagcctggtcgccgct
gcccatgccaagggcatctacatgatggtcgacgttgtcgcaaaccacatgggtcctgga
gcaatcacaaacaaccgccctgaacctctcaaccaagcgtcctcataccacaccgcttgc
aacatcgactacagcaaccaaaacagtgttgagatatgccaaattgccggacttcccgac
atcaacaccaccaagagcgagatacgcacgctcctcaacacctgggtcaactggctcgta
aaggagtacagcttcgatggcgtccgcatcgataccgtcaagcacgtcgaaaaggacttt
tggcctggcttctccgccgctaccggcgtctacaacattggcgaggtattcgacggaaac
ccaagctaccttgccgagtacgccaagctcatgcccggtctcctcaactacgcagtctac
tacccgatgaacaacttttaccagcaaaagggctcttcccaggcgcttgtcgacatgatg
aacactgttagcaacaccttccccgacccagccgccttgggaaccttcctcgacaaccac
gacaacaagcgctggttgaatgtcaagaacgaccagaccctgctcaagaacgctctcgcc
tatgtcattcttgcacgtggtatcccaatcttgtactatggtaccgagcagggatatgct
ggtggtgacgacccagctaaccgagaggatctgtggcgcagtggcttcaacaccaacgcc
aacctctaccaagccatcaagaaactgaccgccgcccgacaggctgctggtggtctcgca
ggaaacgaccatgtccacctgtacgtcgctgacaccgcctacgcctggagccgtgccaac
ggcaacctgattgtcctcaccaccaacgctggcggcaactccaacacccagcactgcttc
aacactcaaaaggccaacggccgctggaccaacgtctacggcaacggtgccaccgtcact
gccgatggcaacggacaaatctgcgtctccgtcacaaacggcgagcccgttgtcctcctc
gccggttccgctactcccaccactggcaccaccctcaccactcgtaccaccaccgccaca
tcaacttcatgccccaccgccgtctctgtctccttcacccaccgcgtcaccaccgtcccc
ggagacaccatcaaaatcactggcaacaccgcccaactcggtaactggactcccgccaac
ggcctcaccttgtccgcagctagctacacctccagcaaccccatctggactattaccgtg
ccactggctgctggatcctccatctcgtacaagtttgtcaagatcaacagtggaggaact
gtcacttgggagagtgatcctaaccggtcgtacaccgcgccaagctgccaggcgagtgct
agtgtgaatagttcgtggcaatag

DBGET integrated database retrieval system