KEGG   Bipolaris oryzae: COCMIDRAFT_94049Help
Entry
COCMIDRAFT_94049  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bor  Bipolaris oryzae
Pathway
bor00071  Fatty acid degradation
bor00410  beta-Alanine metabolism
bor00592  alpha-Linolenic acid metabolism
bor00640  Propanoate metabolism
bor01040  Biosynthesis of unsaturated fatty acids
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01200  Carbon metabolism
bor01212  Fatty acid metabolism
bor04146  Peroxisome
Module
bor_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    COCMIDRAFT_94049
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COCMIDRAFT_94049
   00592 alpha-Linolenic acid metabolism
    COCMIDRAFT_94049
   01040 Biosynthesis of unsaturated fatty acids
    COCMIDRAFT_94049
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCMIDRAFT_94049
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCMIDRAFT_94049
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     COCMIDRAFT_94049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 19128379
NCBI-ProteinID: XP_007687542
JGI: Cocmi1_94049
UniProt: W6Z2J4
LinkDB All DBs
Position
Unknown
AA seq 686 aa AA seqDB search
MAENAQTALMHKARSSSSFNSFDLTCILWGGQSTVLSRRSAFTRIEKALGTYNPALLPQC
YAHTSREALFAQGLETGKACLQDMKEYGHEHFVWITPKYRLVNASPFGHKAILFEPAMQH
NGTAEQQSQWLPLAQAGRILGTYAQTELGHGSFVRGVETTAMFDAETDEFIVHSPTISST
KFWPAGLGFSTTHGAVMARLIVGEKDHGPHIFLVQLRRVEDGRPMPGVEMGDVGLKMGYN
EADNGFASFNHVRIPRSHMLMAHSQLTRDGTFTEDPLRAKLSYSVMLLVRGKMPGAFAVQ
LAQALTIATRYSFVRQQGLGPADALDNEATIMQYKHQHFRLLSLIAKAYAMFFTSRACGA
QYDKLREMQEKNDHSLLPSVHALTAGLKAYVTSEAADGAEDARKMCGGHGYMAISGLPDI
VGALAGGATFEGENYVLWQQVGRHLLKQLDRLQDDDTLEPHTQYLADLDDPNIACAAEGE
QFLVHETQLAVFRHRAQRLATKAHVAIRASSKAPAEAWNEHMMLLISASRAHIEYFTLRS
VVNAISQLPDNTPASLRKVLERMCSLFALSTIINPRSVDALSFIITFDDRPPYLSPSQLD
TIRSLVNSLLDQLLPEAIALTDAWDFSDASLCSAIGMYDGNVYENIMRWVKQLPINQNAW
ENGGVQRGWRECVDPILRGMETRAKL
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatgcccaaaccgccctaatgcacaaagcaagatcctcatcctcattcaac
tccttcgacctcacatgtatcctctggggcggccaatccaccgtcctctcccgccgctca
gctttcacccgcatcgaaaaagccctaggaacctacaaccccgccctcctccctcaatgc
tacgcccacacctcacgcgaagcgctcttcgcccaaggcctggaaacggggaaggcgtgt
ttgcaagatatgaaggagtacggacacgagcatttcgtgtggattacgcccaagtaccgg
cttgtgaatgctagtcccttcggtcacaaagccatcttattcgaaccagccatgcaacac
aacgggaccgcagaacaacaatcgcaatggctgccgctcgcgcaggcaggcaggattctc
ggaacgtatgcgcagacggagttggggcatgggtcgtttgtgcggggtgtagagacgaca
gcgatgtttgatgcagagacagatgagtttattgtccattctcctactatttcctcgacc
aagttctggccggcggggttagggttctcgaccacgcatggagcggtgatggcgcggttg
attgtaggtgagaaggatcatgggccgcatatttttctggtacagttgaggcgcgtggag
gatgggaggccaatgccgggcgtggagatgggggatgtggggttgaagatggggtacaat
gaagcggacaacgggttcgcgtcgtttaaccacgttcgaattcctcgatcgcatatgctt
atggctcatagccaactcacgcgcgatggtacgtttaccgaggatccgctgcgcgcaaaa
ctctcttactcggtcatgcttcttgtccgtggcaagatgcctggcgcctttgccgtacaa
cttgcacaagctttgacaatcgcaacacggtattcttttgtgcggcaacaggggctgggt
cccgcggatgcactggacaacgaagccaccatcatgcaatacaagcatcaacactttcgt
ttactcagtctcatcgcaaaagcgtacgctatgttctttacatcgcgcgcttgtggggct
cagtatgacaagctgcgagagatgcaggagaagaacgatcactctctcctgccatctgta
cacgcactgactgcaggtttgaaagcatacgtcacttcggaagcggctgatggcgccgaa
gatgcccgcaagatgtgtggtgggcatggatacatggctatctcgggtcttccggatatc
gttggcgctctcgctgggggtgccacgttcgagggcgagaactacgtgctgtggcaacag
gttggtcggcacctgctcaagcagctggatcgcctgcaagacgacgacacattggagccg
catacgcagtacttggccgatttggacgatcccaatatagcctgtgcggcagagggtgaa
caatttcttgtgcacgagactcagcttgctgtgtttcgtcatcgtgcacagcgtctggcc
accaaggcacatgtggcgattcgagcctcgagtaaggcaccagcagaggcttggaacgaa
cacatgatgctgcttatttcggcgtcgcgggcgcacattgagtactttactctgcgttcc
gttgtgaatgctatctcacagttgcctgacaacacacctgcaagccttcgtaaggtctta
gagcgcatgtgttcgctctttgcgctctctacaatcatcaatccgcgctctgtggacgca
ctgtctttcatcataactttcgatgatcggccaccatatctctcgccctctcaactcgat
accatccgctcacttgtcaacagcctgcttgatcagcttctacccgaagccattgcactg
acagacgcctgggacttttccgacgccagtctgtgcagtgcgattggaatgtatgacggt
aacgtatacgagaacattatgcgctgggtaaagcaactgccaatcaaccaaaacgcgtgg
gaaaacgggggtgttcagcgcggttggagggaatgcgtcgatccaattttaagaggcatg
gaaacccgggcaaaattgtag

DBGET integrated database retrieval system