KEGG   Bipolaris oryzae: COCMIDRAFT_98547Help
Entry
COCMIDRAFT_98547  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bor  Bipolaris oryzae
Brite
KEGG Orthology (KO) [BR:bor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bor01002]
    COCMIDRAFT_98547
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bor04147]
    COCMIDRAFT_98547
Enzymes [BR:bor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     COCMIDRAFT_98547
Peptidases [BR:bor01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   COCMIDRAFT_98547
Exosome [BR:bor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCMIDRAFT_98547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 19129286
NCBI-ProteinID: XP_007689198
JGI: Cocmi1_98547
UniProt: W6YY82
LinkDB All DBs
Position
Unknown
AA seq 258 aa AA seqDB search
MRFQSMIAAALPALVLSAPTPQWDDVPEESIVGGTTAAAGEYPFIVSLQAGGRHICGGTL
INGNTVVTAAHCSVSSAIGSVSNTAVRVGSLSSNSGGTVVRVSRIVLHPSYAASTSNNDV
AIWKLSSTVTAGGNVGFATLAASGSDPASGSTASVAGWGATREGGSASTTLLKVSVPIVA
RNTCIANYGSLTVTTNMVCAGVTAGGRDSCQGDSGGPLVDANKTLIGIVSWGSGCARPNL
PGVYSRVGTLRSFIDQNA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccagtctatgatcgctgctgcgcttcctgcgctcgtcctctccgctcctact
ccccagtgggatgatgttcctgaggagtccattgttggtggaaccaccgctgctgccggt
gaataccccttcatcgtctctctccaggccggtggccgccacatctgcggtggtaccctc
atcaacggcaacaccgttgttaccgctgcccactgctccgtcagcagcgccattggctcc
gtctccaacaccgctgtccgtgtcggctctttgagctccaactctggcggcactgtcgtc
cgcgtctcccgcatcgtcctccaccccagctacgcggcgagcacctctaacaacgacgtt
gccatctggaagctctctagcaccgtcactgccggtggcaacgttggctttgctaccctc
gccgcctctggctctgaccccgctagtggatccactgcctccgttgctggatggggagct
acccgtgagggtggcagcgcctcgactactctcctcaaggtcagcgtccccattgtggcc
cgcaacacctgcattgccaactacggctccctcaccgttaccaccaacatggtctgcgct
ggtgtcactgctggtggtcgcgactcttgccagggtgactctggcggccctctcgtcgat
gccaacaagaccctcatcggtatcgtctcctggggaagcggctgcgctcgccccaacctt
cccggtgtctactcccgcgtcggcaccctccgcagcttcatcgaccagaacgcttaa

DBGET integrated database retrieval system